KEGG   Leptospirillum ferrooxidans: LFE_1739Help
Entry
LFE_1739          CDS       T01809                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LFE_1739
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LFE_1739
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LFE_1739
Enzymes [BR:lfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LFE_1739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1768020..1769297)
Genome map
AA seq 425 aa AA seqDB search
MSNPSVPIQSDPSAHSGVKALKCRECGRRYELLAIHVCEFCFGPLEVEYDYEVIGRKISR
KSIEAGPVSLWRYKDLLPVLGEPTAGLHAGMTPLVRADRLGRALGLKNLYVKNDTVNHPT
LSFKDRVVAVATTRARELGFTTIACASTGNLANSVSAHAASCGMECFVFIPHDLEAGKVL
GNLIYKPTVVSVKGTYDDVNRLCSEIGAEYPWAFVNINIRPYYAEGSKSLAFETAEQLGW
RVPDQVVVPIASGSLLTKIWKGFHEFTRLGLVDENPLLKVNGAQASGCSPVYQAYVSGKN
HIVPVRPNTIAKSLAIGNPADGFYALDVVGKSGGQVEQATDSEIIDGMKLLAETEGIFAE
TAGGVTVACLKKLAEKGAIRPDELTVAYITGNGLKTMEALAGSLSQPVSIDPNLSSFRQI
VNPKS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacccgtctgtgccaatccagtctgatccttctgcccattccggcgtgaaagcg
ctaaaatgccgtgaatgcggcagaagatatgagcttttagccatacatgtctgtgagttt
tgttttgggcccctggaagttgagtatgattatgaagtcattggacggaagatctctcga
aaatcgattgaggctggtccagtttccctctggagatacaaagatctgttgcctgtcctt
ggagagcctacggctggacttcatgccggtatgacgccactggtacgtgcagatcgcctt
ggtcgggctcttggcctgaaaaacctatacgttaaaaatgacacagtgaatcatccgacc
ttgtctttcaaggatcgggttgtggcggtggcgactacaagagccagggaattaggtttt
acaacaattgcctgtgcttcgaccggcaatcttgccaattcggtttcagctcatgctgcc
agttgcggtatggaatgctttgtttttattccacatgatctggaagcaggaaaggtttta
ggtaacctgatttacaagccaacggtcgtttcagtcaagggaacctatgacgatgtgaac
cggttgtgcagcgagattggcgcagaatatccatgggcttttgtcaatatcaacatacgc
ccatattatgctgaaggctccaagtcgttggcttttgaaacggctgaacagctggggtgg
cgggttccggaccaagttgttgttccgattgcgtcgggatcccttttgacaaaaatctgg
aaaggttttcacgagtttacccgcctcggccttgtggatgaaaatccgcttttgaaggtc
aatggagcccaggcatcgggatgttcgcctgtttaccaggcatatgtttccggaaaaaat
cacattgttcctgttcgtccaaataccattgccaaatctttggcgatcggaaatcctgcc
gacggattttatgctcttgatgttgttggaaagtcaggtgggcaggttgaacaggccacg
gattcggaaatcatcgacggaatgaaacttcttgctgaaacagaaggtatctttgccgag
actgcaggaggggtgactgtggcctgcctgaaaaagctggcagaaaagggagccatacga
ccggatgagctaaccgttgcttatataaccggaaatggacttaaaaccatggaagctctt
gcaggttctttgtcccagccggtcagtatcgaccccaacctgtcttcctttagacagatc
gtcaacccgaaatcctag

DBGET integrated database retrieval system