KEGG   Leptospirillum ferrooxidans: LFE_1792Help
Entry
LFE_1792          CDS       T01809                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LFE_1792
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LFE_1792
Enzymes [BR:lfc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     LFE_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1830196..1831710)
Genome map
AA seq 504 aa AA seqDB search
MKEHPVRKDRQWIKSVLPDPAWGMFPDNIGGLSDDSRSACEGDLFFLRHGKNGVNWAFLE
DAIKAGVRLVVTDSSIRSNWLTEAIFHSVPVVFVDDLLNTMGRVASSFWGNPSEKMKVVA
VTGTNGKTTSSFLTRSVMVQSGIPTGLIGTVVFDIGDEVVEATQTTPGILDLHRLLGEAW
LKGLRGMSMEVSSHALDQGRVSGLSFSVVHFTNLTRDHLDYHPDMESYYQAKKRLFSRQN
PDGSHPICVVNGDDSWGKRLISELVLEKRTPIIIGESQDADISPKNVSIGIDGIRGVIRT
PKGDLHIESPMTGHYNLMNIMGVIGCSIALEIPLDLISRGISAQHGVPGRFEVIRSDRNI
SVIVDYAHTDDALENLLGAVRPLCKGKVITVFGCGGDRDRGKRPRMGEKAGRLSDMVMLT
SDNPRTEDPERILDEIEPALKGTGTPYERIADRKRAIFRAISIARPGDSVVIAGKGHENY
QILGKIKHHFDDREVAREALGIDL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagagcatcctgttcgcaaagaccggcaatggatcaaaagtgttctgcccgatccg
gcttggggaatgtttccggacaatataggggggctatcagatgattcccgatcagcttgt
gagggggatcttttttttctgaggcatggaaaaaatggggttaactgggcgttcctagag
gatgcgataaaagcaggagtccgactcgtcgtaacggattcatccattcgttccaactgg
ttgaccgaagcaattttccattccgtgccggttgtctttgtcgatgatctcctcaatacc
atgggacgggttgcctcatccttctgggggaatccttcggaaaagatgaaggttgtggct
gtgactggcaccaatggtaagacaacttccagttttttgacccgttctgtaatggttcag
tctggtatccccacggggttgattggcactgttgtttttgatattggcgatgaagttgtt
gaagccacccagacgactccgggaattctggatctgcaccgattgttgggggaggcttgg
ttgaaagggctacgtggcatgtccatggaggtctcatcccatgctcttgatcagggacgg
gtttcaggactttctttttcggtggtgcattttaccaacctgactcgagatcatctggat
tatcatcctgacatggagtcctactatcaagccaaaaaacgtcttttctccagacaaaat
ccggatggaagccatccgatatgtgttgtcaatggcgatgactcctgggggaaaaggctc
atctccgaacttgttttggaaaaacggacccctatcattattggcgaaagtcaagatgcg
gatatctctcccaaaaatgtttccataggtatcgatggaatcaggggggtgatccgcacc
cccaaaggtgatcttcatatcgaatctccaatgaccggccactataacctgatgaatatc
atgggcgtgattgggtgctctattgcgctcgaaattcctcttgatctgatctccaggggg
atctctgcccaacatggagttcctggccggtttgaggtcatccggtcggatcggaatata
tcggtgattgtcgattatgcccataccgatgatgccctggagaatttgcttggcgccgtt
cgtccattatgcaagggaaaagtgattactgtttttggatgcggcggggatcgggacagg
gggaagagaccccggatgggtgaaaaagccggaagattgtcagatatggttatgctgact
tcagataatccgagaacggaggatcccgagcggatccttgacgagattgaaccggctctc
aaggggacaggaaccccgtatgagcgtattgccgacaggaaaagagcgatattccgggct
atttccattgccagacccggagatagtgttgtcattgccggtaagggccacgaaaactat
cagattcttggaaaaataaaacatcacttcgatgatcgggaggttgcaagagaagctctg
gggatcgatctgtga

DBGET integrated database retrieval system