KEGG   Leptospirillum ferrooxidans: LFE_1800Help
Entry
LFE_1800          CDS       T01809                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
lfc00020  Citrate cycle (TCA cycle)
lfc00640  Propanoate metabolism
lfc00660  C5-Branched dibasic acid metabolism
lfc01100  Metabolic pathways
lfc01110  Biosynthesis of secondary metabolites
lfc01120  Microbial metabolism in diverse environments
lfc01130  Biosynthesis of antibiotics
lfc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LFE_1800
   00640 Propanoate metabolism
    LFE_1800
   00660 C5-Branched dibasic acid metabolism
    LFE_1800
Enzymes [BR:lfc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     LFE_1800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Citrate_bind
Motif
Other DBs
NCBI-ProteinID: BAM07479
UniProt: I0IQD0
Position
complement(1838074..1839264)
Genome map
AA seq 396 aa AA seqDB search
MNIHEYQAKELFGQYQIPVPKGVMVESVAEAENMIKTNPLFQGASGQVFAVKAQIHAGGR
GKAGGVKITKEFSNIPEIVSGLLGKVLVTHQTGPEGRQVGKVWIEQGSRIDKEFYLGMVV
DRNLRRVTLIASTEGGMEIEEVAQKHPERIFHLSVDPCEGYSPHIGRRLFYFLGLPAETQ
TAFVKLVGDLVRFFHEKDASMVEINPLVLTAEKTLIALDAKVGFDDNAIYRQPVTKVLRD
LAEENPLEIEASKYNLNYVKLDGNIACMVNGAGLAMATMDVIALAGGSPANFLDVGGGAS
KDTVEQAFRLILSDPHVKGIFVNIFGGIVRCERIAGGIIAAAQDVKINVPLVVRLQGTNA
SEGREMLRTSGLAIEVAEELFEGAEKIVLAVKKGGK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttgaatattcatgaataccaagccaaagaactttttggccagtatcagatccctgtcccc
aaaggtgtgatggttgaatcagttgctgaagcagaaaatatgatcaagaccaaccctctt
tttcagggagccagtggtcaagtttttgctgtcaaggcacaaatccatgcaggcggtcgg
ggtaaggctggcggagtcaagatcacaaaggaattctcaaacattcccgaaattgtctcc
ggtctcctcggtaaggttcttgtgacccaccaaactggtccggagggtaggcaggttggc
aaggtctggatagagcaaggctcccggatcgataaagagttttaccttggtatggttgtt
gaccgaaatctccgaagagtgaccctgattgcgagcactgaaggggggatggaaatcgag
gaagtggcccaaaaacatcccgagcggattttccatctttctgtagacccttgtgaaggg
tactctcctcatatcgggcgacgcttgttttattttctgggacttcctgcggagacacag
actgcttttgtcaagctggtgggggatcttgtccgattcttccatgagaaggatgcaagt
atggttgaaatcaacccacttgttctgacagcggaaaaaacgctgatcgctttggatgcg
aaggtcggatttgatgacaatgccatctatcgccagcctgtcacaaaggtgttgagagat
ctcgccgaagaaaatcccctcgagatcgaggcctcaaaatataatctcaattatgtcaag
cttgatggaaatattgcctgcatggtgaatggtgcaggtcttgcgatggcgacaatggat
gtcattgccttggccggaggatctcctgcgaacttcctggatgttggaggaggcgcgagc
aaggatactgttgagcaggcattcaggctgatcttgagcgatcctcacgtcaaggggatt
tttgtcaatatttttggtggaattgtgaggtgcgaacgaatcgctggcggtattattgca
gcagctcaggatgtcaaaatcaatgttcccctggttgttcgacttcagggtacaaacgct
tctgaaggccgagagatgttgcgtacgtccgggcttgccattgaagttgccgaagaattg
tttgaaggtgccgaaaaaattgtccttgcggtgaagaagggggggaaatga

DBGET integrated database retrieval system