KEGG   Leptospirillum ferrooxidans: LFE_2003Help
Entry
LFE_2003          CDS       T01809                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lfc00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:lfc00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2046903..2047940)
Genome map
AA seq 345 aa AA seqDB search
MKSAGSFVDGPGVFLWVSLPGMDLSGSDRIFLEEMRPAGVVLFSENIGPPSSPDSLGRLR
DLIREIRGVLAPVPVILAIDQEGGRVARLQDGVPKLPPMRELSRAGGIPEIFTAGYELGR
ALSSLDIDMDFAPVLDVDSNPDNPVIGDRSFSSDPELAFRYAMTFSQGLSLGGVVPCGKH
FPGHGDTHLDSHFALPTVPDPMDVLLHREIHPFRRAVSWGIPALMTAHVMYPEIDQEWPA
TLSVKISETLLRKRLGFDGLLLSDDFKMAGLRDHFPLTVSVERSLLASCDGLLAMKSEDL
ARQMMEQLHLLSKGKPVWFEKRKTEAVTRLRRVLSMRESSKSWSS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtctgcaggatcatttgtggatggtcctggagtttttctctgggtgagtcttcca
ggtatggatctcagtggctccgatcgaattttcctggaggagatgagacctgccggagtg
gtcctcttttcggagaatatcggacctccatcttctccagattccctggggagactgaga
gatctgatccgggaaatcagaggggtgctggcaccggttccggtgatcctggcgatcgac
caggagggcggaagagttgctcgacttcaggatggagtgccaaaacttccacccatgaga
gaactttcccgggcagggggaatcccggagatttttacggctgggtatgagttgggcagg
gctctttcctctcttgatatcgatatggattttgctcctgtcctggatgttgattccaat
ccggacaatcccgttatcggggatcgatccttttcctccgacccggaattggcatttcgt
tatgccatgaccttttctcaggggctttccctgggaggagtcgtcccttgcggaaaacat
tttccaggccacggggacactcatcttgattcccactttgcattgccgactgtccctgat
ccaatggatgtcctgttgcatagggagattcatcctttcagacgtgccgtttcctgggga
atcccggcgttgatgaccgctcatgtcatgtatccggagatcgatcaggagtggcctgcg
accttgtctgtcaaaatttcggaaacactcctcagaaagcgtcttggattcgacgggctt
ttattgagtgacgatttcaaaatggcaggtctccgggatcacttccctttgaccgtttct
gtggagcgctcccttctggcaagctgcgacggacttttggccatgaagagtgaagatctt
gcaagacagatgatggagcagctccatcttctgtcaaaaggaaagccggtctggtttgaa
aaacgcaaaaccgaggctgtcacccggttaaggagagtgctttcgatgagagaatcctcc
aaaagctggtcatcgtga

DBGET integrated database retrieval system