KEGG   Leptospirillum ferrooxidans: LFE_2003Help
Entry
LFE_2003          CDS       T01809                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LFE_2003
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    LFE_2003
Enzymes [BR:lfc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LFE_2003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2046903..2047940)
Genome map
AA seq 345 aa AA seqDB search
MKSAGSFVDGPGVFLWVSLPGMDLSGSDRIFLEEMRPAGVVLFSENIGPPSSPDSLGRLR
DLIREIRGVLAPVPVILAIDQEGGRVARLQDGVPKLPPMRELSRAGGIPEIFTAGYELGR
ALSSLDIDMDFAPVLDVDSNPDNPVIGDRSFSSDPELAFRYAMTFSQGLSLGGVVPCGKH
FPGHGDTHLDSHFALPTVPDPMDVLLHREIHPFRRAVSWGIPALMTAHVMYPEIDQEWPA
TLSVKISETLLRKRLGFDGLLLSDDFKMAGLRDHFPLTVSVERSLLASCDGLLAMKSEDL
ARQMMEQLHLLSKGKPVWFEKRKTEAVTRLRRVLSMRESSKSWSS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtctgcaggatcatttgtggatggtcctggagtttttctctgggtgagtcttcca
ggtatggatctcagtggctccgatcgaattttcctggaggagatgagacctgccggagtg
gtcctcttttcggagaatatcggacctccatcttctccagattccctggggagactgaga
gatctgatccgggaaatcagaggggtgctggcaccggttccggtgatcctggcgatcgac
caggagggcggaagagttgctcgacttcaggatggagtgccaaaacttccacccatgaga
gaactttcccgggcagggggaatcccggagatttttacggctgggtatgagttgggcagg
gctctttcctctcttgatatcgatatggattttgctcctgtcctggatgttgattccaat
ccggacaatcccgttatcggggatcgatccttttcctccgacccggaattggcatttcgt
tatgccatgaccttttctcaggggctttccctgggaggagtcgtcccttgcggaaaacat
tttccaggccacggggacactcatcttgattcccactttgcattgccgactgtccctgat
ccaatggatgtcctgttgcatagggagattcatcctttcagacgtgccgtttcctgggga
atcccggcgttgatgaccgctcatgtcatgtatccggagatcgatcaggagtggcctgcg
accttgtctgtcaaaatttcggaaacactcctcagaaagcgtcttggattcgacgggctt
ttattgagtgacgatttcaaaatggcaggtctccgggatcacttccctttgaccgtttct
gtggagcgctcccttctggcaagctgcgacggacttttggccatgaagagtgaagatctt
gcaagacagatgatggagcagctccatcttctgtcaaaaggaaagccggtctggtttgaa
aaacgcaaaaccgaggctgtcacccggttaaggagagtgctttcgatgagagaatcctcc
aaaagctggtcatcgtga

DBGET integrated database retrieval system