KEGG   Leptospirillum ferrooxidans: LFE_2333Help
Entry
LFE_2333          CDS       T01809                                 

Definition
(RefSeq) pyruvate ferredoxin oxidoreductase subunit alpha
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LFE_2333
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LFE_2333
   00020 Citrate cycle (TCA cycle)
    LFE_2333
   00620 Pyruvate metabolism
    LFE_2333
   00640 Propanoate metabolism
    LFE_2333
   00650 Butanoate metabolism
    LFE_2333
  Energy metabolism
   00680 Methane metabolism
    LFE_2333
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    LFE_2333
Enzymes [BR:lfc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     LFE_2333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2409028..2410233)
Genome map
AA seq 401 aa AA seqDB search
MGTHENPNVPQIGTPNKKGQIITAPEEIFFNSPRTQAFLTGSEVIKEAVKRSSVDFSVAY
PITPQSEASSLVGELYADGYVGDYMRGESEFAVMGQCAGAAFGGARVFTTTAGPGTLRAF
ENFPMWAGARLPIQVVFTVRGVNSPLTIQPDTLEIAFMLETGMLLWHAEDAQDLFDFMMK
GYIVAELPEVHLPIGVICDGFFVTHTKDVVSMTPENVALPHYNPYANPTPVMDMETAPIR
HMRDPFIMKSNYISYMTHASWQLEVKAAMERSRKMTRKLLNGLIEVENPDAEILLVSSGT
AVSQSREAIRLFRDKGVKVGLVKIKTIRPFPKEEIREATKNAKYIFVPEFNVAGWMAREI
ASVVERNERVIAGPHVAGGMTMPPEVIVEEVERTIARMNKK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgggaacccatgaaaaccccaatgtcccccaaatcgggacacccaataaaaaaggtcag
atcatcactgctcctgaagagatttttttcaactctccccgtactcaagccttccttaca
ggatctgaagtcataaaagaggctgtcaaaagaagcagtgtcgatttctcggttgcctat
cccatcaccccacaaagtgaagcgtcgtcccttgttggcgaattatatgcggatggatat
gtcggcgattacatgagaggcgaatctgagtttgctgttatgggacaatgtgccggtgca
gctttcggcggcgcccgtgtctttaccactacagccggaccaggaacccttcgtgcattc
gaaaacttcccgatgtgggccggagcaaggcttcccattcaggttgtctttaccgtccgg
ggcgtaaactctccgctgacaattcagccggataccctggaaattgcatttatgctcgag
accgggatgctcttgtggcacgcagaagacgcacaggatcttttcgacttcatgatgaaa
gggtacatcgttgccgagcttcccgaggtccatcttccgatcggtgtcatttgtgacgga
ttctttgtgactcatacaaaagatgtcgtgagcatgacgcccgaaaatgtggctcttccc
cattacaatccctatgcgaaccccacccctgtaatggatatggaaacggctccgatccga
cacatgagggatccattcatcatgaaatcaaactatatttcctacatgacccatgccagc
tggcagcttgaagtcaaagcggcaatggagcgctcacggaagatgaccagaaaacttctg
aatggactgattgaagtagaaaaccccgatgctgaaattctcctggtgtcttctggaacg
gccgtttcccagtcaagggaagccatccgcctgttccgtgacaagggcgtgaaagtggga
ttggtcaagatcaagacgatcaggccctttccaaaagaagaaattcgggaagcgacaaaa
aacgccaaatacatttttgtccccgaattcaatgtcgccggctggatggcaagagaaatc
gcctcagttgtcgaaagaaatgagagagttattgcgggacctcatgtcgctggcggtatg
accatgcctccagaggtcattgtcgaagaagtagagagaacgattgccaggatgaacaaa
aaataa

DBGET integrated database retrieval system