KEGG   Leptospirillum ferrooxidans: LFE_2337Help
Entry
LFE_2337          CDS       T01809                                 

Definition
(GenBank) ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
lfc00010  Glycolysis / Gluconeogenesis
lfc00020  Citrate cycle (TCA cycle)
lfc00620  Pyruvate metabolism
lfc00633  Nitrotoluene degradation
lfc00640  Propanoate metabolism
lfc00650  Butanoate metabolism
lfc00680  Methane metabolism
lfc01100  Metabolic pathways
lfc01120  Microbial metabolism in diverse environments
lfc01130  Biosynthesis of antibiotics
lfc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LFE_2337
   00020 Citrate cycle (TCA cycle)
    LFE_2337
   00620 Pyruvate metabolism
    LFE_2337
   00640 Propanoate metabolism
    LFE_2337
   00650 Butanoate metabolism
    LFE_2337
  Energy metabolism
   00680 Methane metabolism
    LFE_2337
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    LFE_2337
Enzymes [BR:lfc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     LFE_2337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: BAM08009
UniProt: I0IRW0
Position
complement(2412197..2412892)
Genome map
AA seq 231 aa AA seqDB search
MNKERYNIRMAGIGGQGVVTASHILSNGMVIMGGESTLVPFFGSEKRLAPVESYVRIANG
KIYEIGEIIYPNLIMIFHPQVITHGKSYTMPFYSGLKPNGVVLINSETPINLVADEEREL
MERNARVYYLPATQLSREIADTDLATNMAMVGAVSAIMGIPDLPSLEQSVKERFLGKGFV
VSGGTAALDNVIERKFAKKEQLLKKNMEVIVAAYNFAVERGWAKVKEKVQV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggaacgctataacatcagaatggccggtatcggtggtcagggagttgttacc
gcatcccacattctcagtaatggaatggtgatcatgggcggagaaagcacgctcgtccca
tttttcggttcggaaaagagacttgcgccggttgagagctatgtcaggatcgccaatgga
aaaatctatgaaatcggagagatcatctacccgaatttgatcatgatcttccatcctcag
gtgatcacccatggtaaatcctataccatgccgttctattccggcttgaagcccaatggt
gtggttttgatcaactcggagactccgatcaatctcgttgccgatgaggaaagagaattg
atggagagaaatgccagagtctattacttacctgcaacacagctctcaagagaaattgcc
gatacggaccttgccaccaatatggccatggttggtgctgtcagcgctattatgggcatc
cctgatcttccatcccttgaacaatcggtcaaggagagattccttggcaagggatttgtt
gtgtcaggaggaactgcagccctggacaacgtcattgagcgcaagttcgcgaaaaaagag
cagttgttgaagaagaacatggaagtcattgttgccgcttataattttgcagtcgaacgt
ggctgggcaaaggtgaaagagaaagttcaggtttaa

DBGET integrated database retrieval system