KEGG   Leptospirillum ferrooxidans: LFE_2353Help
Entry
LFE_2353          CDS       T01809                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lfc03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2430148..2431023
Genome map
AA seq 291 aa AA seqDB search
MPELPEAETIRKQLLPVLLGSRVRSLRSGPYPKIFLSDIPDLSGWQFSDLGRIGKVLLFS
MKSPAGESGTLLTRLGMSGQWNISGNRQDSQLPLQPSQTTIHTHLAITLETPEGERLLSY
RDPRRFGRVEWQTDIALSGILQTTGPDILKIRAEQFEHSIRASRRSIRTILLDQKIASGI
GNIYVSEILFESGIHPDRKGFRITGAEARRILESSAVVLQKAIDRGGSSIHSFKDAFGEE
GGNQSQLQVYGLDGSPCPLCKSPILKKEEGGRSSYFCLRCQPKKRTSPARS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacttccagaagccgaaacaatccgcaaacaacttcttcccgttcttttggga
tcccgtgtgcgctctctccggagcggcccttatccaaaaatcttcctgtccgacataccg
gatctttcgggatggcaattttccgacttgggccgcatcgggaaagttcttcttttctcc
atgaaatctcctgccggtgagtccgggacgctcctgaccagactcggcatgtcggggcaa
tggaacatatccggtaacaggcaggattcccaactccccctccaaccctcccaaacaacc
attcatacccatctggccatcactcttgagacccccgaaggcgagaggctcctgtcttac
cgggatccccgacgtttcggacgagtcgagtggcaaaccgacatagctctttccgggatc
cttcaaacgaccggccccgatattctcaaaatccgggccgaacagtttgaacacagtatc
cgggcttcccggcgttcgatccggacgattctcctcgaccagaagatcgcgagtgggatc
gggaatatctatgtctcggaaattctttttgaatccgggatccacccggaccggaaaggc
ttccggataacaggggccgaggcgcgccgcatcctcgaatcttccgcagttgtcctccag
aaagccatcgatcgtggaggaagctctatccacagctttaaggacgccttcggagaagaa
ggggggaaccagagccagctgcaggtgtatggactcgatggatcaccttgtccactctgc
aagagtccgattctcaaaaaagaggagggaggccgatccagttatttttgcctgcgttgc
cagcccaaaaaaagaacatcccccgccaggtcctga

DBGET integrated database retrieval system