KEGG   Lactobacillus fermentum IFO 3956: LAF_0056Help
Entry
LAF_0056          CDS       T00699                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lfe01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lfe00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
70482..71630
Genome map
AA seq 382 aa AA seqDB search
MDQTERTRVLSDLVKINSVNGNELEVANYLRRLFEQHGLTADVQPFGEQRANLIVEVGAG
KPILGITGHMDTVALGDEKKWHHAPLSATIEGDRLYGRGAADMKSGLAAQVIALIELVES
GTLTGHVRFIATAGEEYGTPGANRLEEAGVAKDLNALVVGEPTSGNVIYAHSGSYNYRIV
STGQAVHSSEPERGQNALEPLVDFALAERDLFFDVPDDPCLGPLKHSVTIIQGGEQVNTI
PDYAELRGNIRPTMRFDNDHVTARLQAAVDRLNQEGAAHLTLEVLHSWRPVASNPNGDFV
KRALQASQEAFAKYPGHATPELGVIHGATDASVFVKHHHDLPVILLGADDWNISHQVNEY
TTLSSFEATIEAYKRLIPAFFE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaccgaacggacccgggtgcttagcgacctggtcaaaattaatagtgtcaac
ggcaatgaactagaagtggccaattacttgcgccgcctgtttgaacagcacgggttgacg
gccgacgtccagcccttcggcgagcagcgggccaacctgattgtagaggtgggcgccggt
aaaccaatcctggggatcaccggccacatggacacggtcgccctgggcgatgaaaagaag
tggcaccacgcccccctgagcgccacgattgaaggggaccgcctgtacggacgaggggcc
gccgacatgaagtcgggcctggccgcccaggtgattgccctgattgaattggttgaatca
ggaaccctgactggtcacgtccgcttcatcgctacggccggtgaggagtacgggaccccg
ggtgctaaccgcctggaagaagcgggggtggctaaggacctgaacgccctggtggtcggg
gagcccaccagcgggaacgtcatctacgcccactcgggaagctacaactaccggatcgtt
tcaactggccaggcggtgcactcttcggaaccggaacgcggccaaaatgccctggagccc
ctggtcgactttgccctggccgaacgcgacctcttctttgacgttccggatgacccctgc
ctggggccgctcaagcactcggtgacgattattcaagggggcgagcaggtcaacacgatc
ccggactacgcggaactgcgggggaacatccgccccacgatgcgctttgataacgaccac
gtcaccgcccgtttgcaggccgccgtggaccggcttaaccaggagggtgctgcccattta
accctggaagtgctccactcctggcgcccggtggcctccaatcccaacggtgactttgtc
aagcgggccctacaagctagccaggaggcctttgcaaagtacccggggcacgcgacccca
gaactcggggtcatccacggggcgaccgacgcttcggttttcgtcaagcaccaccacgac
ctgccggtgattttactgggggccgacgactggaacatttcccaccaagttaacgagtac
accaccctgtcttcttttgaggcaacgattgaagcttacaagcgcttgatcccggccttt
tttgagtaa

DBGET integrated database retrieval system