KEGG   Lactobacillus fermentum IFO 3956: LAF_0056Help
Entry
LAF_0056          CDS       T00699                                 

Definition
(GenBank) peptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
lfe00300  Lysine biosynthesis
lfe01100  Metabolic pathways
lfe01120  Microbial metabolism in diverse environments
lfe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LAF_0056
Enzymes [BR:lfe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LAF_0056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: BAG26392
UniProt: B2GF03
Position
70482..71630
Genome map
AA seq 382 aa AA seqDB search
MDQTERTRVLSDLVKINSVNGNELEVANYLRRLFEQHGLTADVQPFGEQRANLIVEVGAG
KPILGITGHMDTVALGDEKKWHHAPLSATIEGDRLYGRGAADMKSGLAAQVIALIELVES
GTLTGHVRFIATAGEEYGTPGANRLEEAGVAKDLNALVVGEPTSGNVIYAHSGSYNYRIV
STGQAVHSSEPERGQNALEPLVDFALAERDLFFDVPDDPCLGPLKHSVTIIQGGEQVNTI
PDYAELRGNIRPTMRFDNDHVTARLQAAVDRLNQEGAAHLTLEVLHSWRPVASNPNGDFV
KRALQASQEAFAKYPGHATPELGVIHGATDASVFVKHHHDLPVILLGADDWNISHQVNEY
TTLSSFEATIEAYKRLIPAFFE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaccgaacggacccgggtgcttagcgacctggtcaaaattaatagtgtcaac
ggcaatgaactagaagtggccaattacttgcgccgcctgtttgaacagcacgggttgacg
gccgacgtccagcccttcggcgagcagcgggccaacctgattgtagaggtgggcgccggt
aaaccaatcctggggatcaccggccacatggacacggtcgccctgggcgatgaaaagaag
tggcaccacgcccccctgagcgccacgattgaaggggaccgcctgtacggacgaggggcc
gccgacatgaagtcgggcctggccgcccaggtgattgccctgattgaattggttgaatca
ggaaccctgactggtcacgtccgcttcatcgctacggccggtgaggagtacgggaccccg
ggtgctaaccgcctggaagaagcgggggtggctaaggacctgaacgccctggtggtcggg
gagcccaccagcgggaacgtcatctacgcccactcgggaagctacaactaccggatcgtt
tcaactggccaggcggtgcactcttcggaaccggaacgcggccaaaatgccctggagccc
ctggtcgactttgccctggccgaacgcgacctcttctttgacgttccggatgacccctgc
ctggggccgctcaagcactcggtgacgattattcaagggggcgagcaggtcaacacgatc
ccggactacgcggaactgcgggggaacatccgccccacgatgcgctttgataacgaccac
gtcaccgcccgtttgcaggccgccgtggaccggcttaaccaggagggtgctgcccattta
accctggaagtgctccactcctggcgcccggtggcctccaatcccaacggtgactttgtc
aagcgggccctacaagctagccaggaggcctttgcaaagtacccggggcacgcgacccca
gaactcggggtcatccacggggcgaccgacgcttcggttttcgtcaagcaccaccacgac
ctgccggtgattttactgggggccgacgactggaacatttcccaccaagttaacgagtac
accaccctgtcttcttttgaggcaacgattgaagcttacaagcgcttgatcccggccttt
tttgagtaa

DBGET integrated database retrieval system