KEGG   Lactobacillus fermentum IFO 3956: LAF_0135Help
Entry
LAF_0135          CDS       T00699                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LAF_0135 (gpmA)
   01230 Biosynthesis of amino acids
    LAF_0135 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAF_0135 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    LAF_0135 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LAF_0135 (gpmA)
Enzymes [BR:lfe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LAF_0135 (gpmA)
Exosome [BR:lfe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LAF_0135 (gpmA)
  Exosomal proteins of melanoma cells
   LAF_0135 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
161528..162223
Genome map
AA seq 231 aa AA seqDB search
MAKLVLIRHGQSEWNLSNLFTGWVDVDLSEKGVEQAKAAGKAIKEHGLEFDYAYTSVLKR
AIKTLHYALEESDQMWIPEFKTWRLNERHYGALQGKNKADAAEKYGDEQVHIWRRSYDVL
PPLLSADDEGSAAKDRRYADLDPRAIPGGENLKVTLERVIPLWQDEIAPKLLDGKNVIIA
AHGNSLRALSKYIENISDEDIMGLEMATGQPVVYDFDEKLNVLSKEKYDID
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattagtactgattcgtcacgggcaaagcgaatggaacctgtccaacctgttt
actggctgggttgacgtcgacctgagcgaaaagggtgttgaacaagcaaaagccgccggt
aaggcgatcaaggaacacgggctggaatttgattacgcctacacttctgttttgaagcgg
gcaatcaagaccctccactacgcactggaagaatccgaccaaatgtggatcccagaattc
aagacttggcgcttgaacgaacgtcactacggggcattgcaaggcaagaacaaggccgac
gccgctgaaaagtacggtgacgaacaagtgcacatttggcgccgttcttacgacgtgctg
ccgccgctgctgagtgctgatgacgaaggttctgccgcaaaggaccgtcgttacgctgac
ttggacccacgcgccattccgggtggggaaaacttgaaggtcaccctggaacgggtaatc
ccgctttggcaagacgaaatcgcaccaaagctcttggacggcaagaacgtgatcatcgcc
gcccacggtaactccctgcgtgccttgagcaagtacatcgaaaacatctccgacgaagac
atcatgggcttggaaatggctactggtcaaccggtcgtttacgacttcgatgaaaagctg
aacgtgctcagcaaggaaaagtacgacattgattaa

DBGET integrated database retrieval system