KEGG   Lactobacillus fermentum IFO 3956: LAF_0169Help
Entry
LAF_0169          CDS       T00699                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
lfe00010  Glycolysis / Gluconeogenesis
lfe00071  Fatty acid degradation
lfe00350  Tyrosine metabolism
lfe00625  Chloroalkane and chloroalkene degradation
lfe00626  Naphthalene degradation
lfe01100  Metabolic pathways
lfe01110  Biosynthesis of secondary metabolites
lfe01120  Microbial metabolism in diverse environments
lfe01130  Biosynthesis of antibiotics
lfe01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAF_0169
  Lipid metabolism
   00071 Fatty acid degradation
    LAF_0169
  Amino acid metabolism
   00350 Tyrosine metabolism
    LAF_0169
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LAF_0169
   00626 Naphthalene degradation
    LAF_0169
Enzymes [BR:lfe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LAF_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: BAG26505
UniProt: B2GFB6
Position
210556..211596
Genome map
AA seq 346 aa AA seqDB search
MKSAMFMKRGLVEVQDVDKPTVKNPDDVVIKVLRACVCGSDLWAYRGLDDKPANSINSGH
EAIGIVEEVGADITTVKPGDFVIAPFTHGCGHCPACLAGFDGVCQDHSDNFSNGTQAEYY
LAQHAQWSLVKVPGKPEDYSEAMLKSFLTLADVMATGYHAARVADVKPGDTVVVMGDGAV
GLSAIIAAKLRGAKRIISTSRHNDRRELAAEFGATDNVAERGDEAVEKILAMTNGGADAV
LECVGTAQSTDTAMKVGRPGAIVGRVGLPHDATMDMATPFYRNTAVAGGPASVTTYDKDL
LLKAVLDGKINPGKVFTKTFTLDEINDAYQAMADRQVIKSYVKVSD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgcaatgtttatgaaaagggggctcgttgaagtccaagacgttgacaagccg
accgttaagaacccagacgatgtcgtgattaaggttttacgggcctgcgtttgtggttcc
gacctctgggcttaccggggcttagatgacaagccggccaactcaatcaacagtggtcac
gaagccattgggatcgtggaagaagtcggcgcagacatcaccacggttaagccgggcgac
tttgtgatcgctccgttcacgcacggctgtggccactgtccagcctgcttagctggtttt
gacggggtttgccaagaccacagtgataacttctccaacgggacccaggctgaatactac
ctggcccaacacgcacagtggagcttggtgaaggtaccaggtaagccggaagactacagc
gaagccatgctcaagtcctttttgaccctggccgacgtaatggctactggttaccacgcc
gcacgcgttgccgacgttaagccgggcgacacggtggtggtaatgggtgacggggccgtt
ggtttgagcgccatcatcgccgctaagctacgcggcgccaagcggatcatctcaacttct
cgtcacaatgaccgccgcgagttagccgctgaatttggtgctaccgacaacgtggccgaa
cgtggcgacgaagcggtggaaaagatcctcgccatgactaacggcggggccgacgccgtc
ctcgaatgcgtggggaccgctcaatcgaccgacaccgccatgaaggtgggtcgtccgggc
gccatcgttggccgggttggtttgccacacgacgctaccatggacatggccacgccgttc
taccgcaacaccgccgttgctgggggcccagcctccgttaccacctacgacaaggacctg
ctcttaaaggccgtcttggacggtaagatcaacccggggaaggtcttcaccaagaccttc
accctggatgaaatcaacgacgcctaccaagccatggctgatcgtcaggtcatcaagagc
tacgtgaaggttagcgattaa

DBGET integrated database retrieval system