KEGG   Lactobacillus fermentum IFO 3956: LAF_0190Help
Entry
LAF_0190          CDS       T00699                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LAF_0190 (ipk)
Enzymes [BR:lfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LAF_0190 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
235201..236052
Genome map
AA seq 283 aa AA seqDB search
MIVTEKAPAKINLALDTPMRYLDGLPRWNMVMNAVDLADYVTVEIHHRPQTIKVYTNSGF
LPNDQRNLAYQAAHILKTRFHQTDGVTIRIKKKIPVAAGLGGGSSDAAAVLRALNKAWRL
GLSLDELARLSLSIDSDVPFCVYSQTAHVTGHGEIVEPLPAFPHYWVVIAKPKLSVSTPV
ILRQINYERLVHPQTDQLVEAIKEGKFQESFQYMGNALEAVTMEAHPEIARLKERMQKLG
ADVAQMSGTGPSVFALCHAESRAKRIYNSLRGFCPEVYQVVLL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtgacggaaaaggcaccggccaagattaacttggccctcgatacgcccatgcgc
taccttgacggcctgccccgctggaacatggtgatgaacgccgttgacctggctgattac
gtcaccgtggagattcaccaccgaccacagacgatcaaggtttacaccaacagcggtttt
ttacccaatgaccaacgcaacctagcctaccaagccgcccacatcctaaagacccgcttt
caccagactgatggggttaccatccgaatcaaaaagaagattccggtggcggccggcctc
ggtggcgggtcttcggacgcggcggccgtcttgcgggccctcaataaggcctggcgcctt
ggtttatcgttagacgagttggcgcgcttatccttatcaatcgattccgacgtgccattt
tgcgtgtactcccaaacggcccacgtgaccggccacggggagatcgtggaacccctgccg
gcctttccccactactgggtggtgattgccaaacccaagctatcagtctcgaccccggtt
atcttacgccagattaattacgagcgtttggtccacccgcaaacggaccagctggtggaa
gccatcaaggaaggaaagtttcaggagagctttcagtacatgggtaacgccctagaggcg
gtgaccatggaggcccaccccgaaatcgcccgtttaaaggaacggatgcaaaaattaggg
gccgacgtggcacagatgagcgggactggtcccagtgtcttcgccttgtgccacgccgaa
tcacgggccaagcgcatttataacagcctgcgtggcttttgcccggaggtctaccaagtc
gtcttgttataa

DBGET integrated database retrieval system