KEGG   Lactobacillus fermentum IFO 3956: LAF_0203Help
Entry
LAF_0203          CDS       T00699                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LAF_0203
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LAF_0203
Enzymes [BR:lfe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     LAF_0203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
248458..249726
Genome map
AA seq 422 aa AA seqDB search
MKKMIIQGGNRLSGEVTIGGAKNSTVALIPSAILADTPVQFDTVPDILDVHNLMIILESM
NVHSSFKHGVLDIDPTQIIEAELPSKAIKSLRASYYFMGALLGRFHRATLTFPGGDNIGP
RPIDQHLKAFEALGATVSENNGTVHLEAPNGLHGTRIFMDMVSVGATINAILAAVRAEGV
TIIENAAREPEIVDLATFLNNMGAQIRGVGTDVIRITGVNSLQSMNTHTIIADRIESGTY
LSLAAAMGDGVMINNVIPEHLEAYTSKLIEMGVDLKIDSDKIYVPKAEHLTAVHVKTMPY
PGFATDLQQPLTPLMAKAAGVSTVVDTIYPKRVKHIPELQKMGMKIAAGDGKITIEHTDH
FNGADVEAGEIRAGASLVITGLMADGQTVIHKADNILRGYDRIVWKLNRLNANVRIEDDE
QD
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgatcattcaaggagggaaccgactctcgggcgaagtaacgatcggtggc
gccaagaatagcaccgtcgcgctcattccatcggcgatcctggccgatactcccgtccag
tttgatactgtgccggacatcctggatgttcacaatcttatgattatcttagagtcaatg
aacgtgcactcttcctttaagcacggggtgttagacattgacccaactcaaatcattgaa
gccgaactgcctagcaaggccattaagagtttgcgggcatcgtattactttatgggagcg
ctactcggccgcttccaccgggcaaccttaaccttccccgggggcgataacattggcccc
cggccgatcgaccaacacttaaaggcctttgaagccctgggtgctaccgttagtgaaaac
aacgggaccgtccacttggaggcaccaaatggcctgcacggaacgcggatcttcatggac
atggtgtccgtgggggccacgatcaacgccatcttggcggcggtccgtgccgaaggggta
acgattatcgaaaacgccgcccgggaaccagagattgtggaccttgccacctttttgaat
aacatgggggcgcagatccgcggggtcggaaccgacgtgattcggattaccggggtgaac
tccctgcaatcgatgaacacgcacacgatcattgcggaccggattgaatccggcacctac
ctttcccttgcggccgccatgggcgatggggtgatgatcaataacgtcatccctgaacac
ttggaagcctacactagtaagttgatcgaaatgggggttgatttgaagatcgattccgat
aagatctacgtgcctaaggcggagcacttaacggcggttcacgttaagacgatgccgtac
ccgggctttgctaccgacttacaacaaccgttgaccccgttgatggccaaggccgccggg
gtaagcacggtggtggatacgatctatcctaagcgggtcaagcacatccccgaattgcaa
aagatggggatgaagatcgcagccggcgacggaaagattacgatcgagcacaccgatcac
tttaacggcgctgacgttgaggccggtgaaattcgggccggggcttccctggtgattacc
gggttaatggcagacggtcaaaccgttatccacaaggccgacaacatcctacgtggttac
gaccgcattgtttggaagctcaatcgtctaaacgccaacgtccggattgaagacgatgag
caagactag

DBGET integrated database retrieval system