KEGG   Lactobacillus fermentum IFO 3956: LAF_0248Help
Entry
LAF_0248          CDS       T00699                                 

Definition
beta-galactosidase small subunit
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LAF_0248
  Lipid metabolism
   00600 Sphingolipid metabolism
    LAF_0248
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LAF_0248
Enzymes [BR:lfe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LAF_0248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
315818..316780
Genome map
AA seq 320 aa AA seqDB search
MDYTNKLHVVYDDNILGLDGKDFQYLFSYEQGGPESFKIKGKEWLYRSPRPTFWRATTDN
DRGNGFNVSSVQWLAADYVLPCQDIALQVDGKDKKLPLAPKTNRYSNQEFAKKVKITFTY
QTQTVPATTVQVSYTVKASGKIKVNVHYTGAQLPSLPVLGWRMIMPTPATSFDYEGLSGE
TYPDRMAGGIEGTYHVEGLPVTPYLVPQENGMHMANKWVQITRATTLNNADPDAAPFRLK
FEAPKKGKLNFSCLPYTSAELENATHPEELPAAHRTVLVIAGEVRGVGGIDSWGADVEEK
YHIDATVDHDFSFKIVPELN
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggattacacaaataagctgcacgtcgtttacgacgacaacatcttaggactggacggc
aaggactttcagtacctcttctcctatgaacaaggggggccggaatcctttaagattaag
ggtaaggagtggctttaccggagcccgcgccccactttttggcgggcaacgaccgataac
gaccgcgggaacggcttcaacgtctcgtcggttcaatggttagcggccgactatgttttg
ccgtgccaagacatcgccttacaagtcgacggtaaggataagaagctaccgctagcacca
aaaaccaaccgctattctaaccaagaatttgccaagaaggttaaaatcacctttacctac
cagacccagacggtaccggcgacgacggtccaagtttcctacacggtcaaggctagtggt
aagatcaaggtcaacgttcactacaccggggcccagttaccaagcctgccggtattgggt
tggcggatgatcatgccgacgccggccactagctttgattacgaagggctatccggggaa
acctacccggaccggatggccggggggatcgagggaacctaccacgtggaagggttgccg
gtgaccccatacttggttccgcaagaaaacgggatgcacatggccaataagtgggttcaa
attacccgcgccaccaccttgaacaacgccgacccggatgcggcaccgttccgcttgaag
tttgaggcccctaagaagggaaagttaaacttctcgtgcttgccgtacaccagcgcggaa
ttggaaaacgccacccacccagaggaattaccagctgcccaccggacggtactggtgatt
gccggtgaagtgcggggggtcggggggattgactcctggggcgccgacgtggaagaaaag
taccacattgacgccacggtggatcacgacttctcctttaagatcgtgcccgagcttaac
taa

DBGET integrated database retrieval system