KEGG   Lactobacillus fermentum IFO 3956: LAF_0250Help
Entry
LAF_0250          CDS       T00699                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:lfe01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lfe01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lfe00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:lfe00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lfe00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
318167..318844
Genome map
AA seq 225 aa AA seqDB search
MTKLVMVRHGQSQANLDNRFTGWSDVPLTAKGIAQGKEVGAELAAREFSFTDVHTSYMKR
AIMTADYILEALDQLYLPIHKTWRLNERHYGALSGLNKEAVKREVGEQQLHAWRRGFFAV
PPQLAHPAHDRRYDRLGVKEPLAESLEMCLERILPYWQDQVAPRLLAGHDQLIVAHGSTL
RALVKYIEGISDDQIDQVEVLNGQPIIYQFDDHLVPVHKEILMEE
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaactggtgatggtgcgtcatgggcagagtcaggctaacctagacaatcgtttc
acggggtggagcgatgtaccactgacggccaaagggattgcccagggtaaggaggtgggg
gcggaactagccgcccgcgagttcagctttaccgacgttcacacgtcctacatgaagcgg
gcgatcatgaccgccgattacattttggaggccctggatcagttatacctgccgatccac
aaaacgtggcggctgaatgaacgccattacggcgccctaagtggcctcaacaaggaggcg
gttaaacgagaagttggcgaacagcagttacacgcttggcgccggggcttctttgccgtc
ccgccccaacttgctcaccccgctcacgaccggcgctacgatcggttaggggtaaaagag
ccactggccgaaagcctggaaatgtgcctagagcggatccttccctactggcaagaccag
gtggcgccccgcctccttgccggccacgatcagttaatcgtggcccacgggagtaccctg
cgcgctttggtcaagtacattgaggggatcagcgatgaccaaattgaccaggtggaggtc
ttaaacgggcaaccgattatttaccaatttgacgaccacctcgtccccgtacacaaggaa
attttaatggaggaataa

DBGET integrated database retrieval system