KEGG   Lactobacillus fermentum IFO 3956: LAF_0250Help
Entry
LAF_0250          CDS       T00699                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LAF_0250
   01230 Biosynthesis of amino acids
    LAF_0250
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAF_0250
  Energy metabolism
   00680 Methane metabolism
    LAF_0250
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LAF_0250
Enzymes [BR:lfe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LAF_0250
Exosome [BR:lfe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LAF_0250
  Exosomal proteins of melanoma cells
   LAF_0250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
318167..318844
Genome map
AA seq 225 aa AA seqDB search
MTKLVMVRHGQSQANLDNRFTGWSDVPLTAKGIAQGKEVGAELAAREFSFTDVHTSYMKR
AIMTADYILEALDQLYLPIHKTWRLNERHYGALSGLNKEAVKREVGEQQLHAWRRGFFAV
PPQLAHPAHDRRYDRLGVKEPLAESLEMCLERILPYWQDQVAPRLLAGHDQLIVAHGSTL
RALVKYIEGISDDQIDQVEVLNGQPIIYQFDDHLVPVHKEILMEE
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaactggtgatggtgcgtcatgggcagagtcaggctaacctagacaatcgtttc
acggggtggagcgatgtaccactgacggccaaagggattgcccagggtaaggaggtgggg
gcggaactagccgcccgcgagttcagctttaccgacgttcacacgtcctacatgaagcgg
gcgatcatgaccgccgattacattttggaggccctggatcagttatacctgccgatccac
aaaacgtggcggctgaatgaacgccattacggcgccctaagtggcctcaacaaggaggcg
gttaaacgagaagttggcgaacagcagttacacgcttggcgccggggcttctttgccgtc
ccgccccaacttgctcaccccgctcacgaccggcgctacgatcggttaggggtaaaagag
ccactggccgaaagcctggaaatgtgcctagagcggatccttccctactggcaagaccag
gtggcgccccgcctccttgccggccacgatcagttaatcgtggcccacgggagtaccctg
cgcgctttggtcaagtacattgaggggatcagcgatgaccaaattgaccaggtggaggtc
ttaaacgggcaaccgattatttaccaatttgacgaccacctcgtccccgtacacaaggaa
attttaatggaggaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system