KEGG   Lactobacillus fermentum IFO 3956: LAF_0259Help
Entry
LAF_0259          CDS       T00699                                 

Definition
glutamyl-tRNA synthase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    LAF_0259
Enzymes [BR:lfe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     LAF_0259
Amino acid related enzymes [BR:lfe01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   LAF_0259
Transfer RNA biogenesis [BR:lfe03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LAF_0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
326454..327950
Genome map
AA seq 498 aa AA seqDB search
MSKNEIRVRYAPSPTGHLHIGNARTALFNYLFARHNHGKFIIRIEDTDTKRNIADGERSQ
LDNLKWMGLDWDEGPDKGGDFGPYRQSERKDIYAQYIQELMDKGLAYKSYMTEEELEAQR
EAQKAAHQMPHYEYEYAGMSDDQIKAAQEAAEEKGLKPVIRFRVPKDEVFEWEDLVKGPM
SFEAQSIGGDFVIQKRDGMPTYNFAVVIDDHLMKISHVFRGDDHVSNTPKQMAIYQALGW
KVPEFGHMSLIINNETGKKLSKRDESVLQFIEQYRDLGYLPEAMDNFIILLGWSPVGEDE
IFSLKEFVKMYDEKRLSKSPAAFDRKKLQWINNQYMKLSSADEVFHVAMPQLLDAGLIEK
NANPYKMEWMRRLVELFKREISYAREIVDYVKPFVNGPEDISEEAKAEMQEDTALVVIKA
FRDRVAAMDFMDATGVLAAIKDVQKSTKVKGRKLWMPLRIAVTHETHGPELPESIELFGQ
EKTLAHLDEMIAQLEENK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaaagaatgaaattcgcgttcgttacgctcctagtccgaccggacacctacacatt
gggaacgcacggaccgcattgttcaactacttatttgcccggcacaaccacggaaagttt
atcatccggattgaagacaccgacaccaagcgcaacattgcggacggggaacgcagccag
ctcgacaacctgaagtggatggggctggactgggatgaaggtccggataagggcggcgac
tttggtccttaccgccaatccgaacgtaaggacatctatgcccaatacattcaagaatta
atggataagggcctggcttacaagtcctacatgaccgaagaggaactggaggcccaacgg
gaagcccaaaaggcggcccaccaaatgccacactatgaatacgaatatgccggcatgagc
gatgaccaaatcaaggcggcccaagaagcagccgaagaaaagggattaaagccggtcatc
cggttccgggtacctaaggatgaagtctttgaatgggaagacctggttaagggacccatg
tcgtttgaggcccaatcaattgggggcgactttgtcatccaaaagcgcgacgggatgcca
acgtacaactttgccgttgtcattgacgaccacctgatgaagatcagccacgtgttccgc
ggcgatgaccacgtttctaacacgccaaagcaaatggccatctaccaagccctgggctgg
aaggtaccggaatttggccacatgtccttgatcatcaataacgaaaccggtaagaagctt
tccaagcgggacgaatcggtgctccaattcatcgagcaataccgcgacctggggtacctg
ccggaagcaatggataacttcatcatcctcttgggctggtccccggttggggaagacgaa
atcttctccttaaaggaattcgttaagatgtacgatgaaaagcggctgtccaagtcacca
gccgcctttgaccgcaagaagctccagtggatcaacaaccagtacatgaaactttcgtca
gccgatgaggtcttccacgtggccatgccacagctgttggacgctggtttgattgaaaag
aacgccaacccatacaagatggaatggatgcggcggttagtggaactcttcaagcgcgaa
atttcttacgcaagagaaattgtcgactacgttaagccgtttgtgaacggcccggaagac
atttctgaagaagcgaaggccgaaatgcaagaagacaccgccctggtagtgattaaggcc
ttccgggaccgggtcgccgccatggacttcatggacgcaaccggtgtcttagccgccatt
aaggacgtgcaaaagagtaccaaggtgaaggggcgcaagctctggatgccactgcggatc
gccgtaacccacgaaacgcacgggccggagttaccggaaagcatcgaactctttgggcag
gaaaagaccttggcccacttggatgagatgattgcccagttagaagaaaacaagtaa

DBGET integrated database retrieval system