KEGG   Lactobacillus fermentum IFO 3956: LAF_0277Help
Entry
LAF_0277          CDS       T00699                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LAF_0277
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAF_0277
   00620 Pyruvate metabolism
    LAF_0277
   00650 Butanoate metabolism
    LAF_0277
  Lipid metabolism
   00071 Fatty acid degradation
    LAF_0277
  Amino acid metabolism
   00350 Tyrosine metabolism
    LAF_0277
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LAF_0277
   00626 Naphthalene degradation
    LAF_0277
Enzymes [BR:lfe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LAF_0277
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LAF_0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
344360..346963
Genome map
AA seq 867 aa AA seqDB search
MAKQSEPQKMTKTEKMVDDLVQKAHQALDIMSEFDQKKVDYITHQMVEAGQDKHMELAIE
AVKETGRGIVEDKAIKNMFATEEIWHNIRKDHTVGVIEDNKADELITVAEPLGVLAGITP
VTNPTSTTLFKAIIAMKTRNPIIFSFHPQALECSRHAARIVRDAAIAAGAPEGAIQWIDE
PSRESSTALINNPGIACTLATGGPGMVRAAYSTGKPALGVGPGNGPVYIEKTAKIARAVN
DIVLSKTFDNGMICATENSAVIDHEIYDEVKADLKANRVYFVPQNEHAKLRKVMFNEQTG
GVNGPIAGKSAMQIAEMADIKVPEDTQVLAVEVNAIGKQELLSGEKLSPVLSVYKAMDQQ
DAFDKCEALLNYGGLGHTAAIQTQNMDLAREFGVAMKASRIIVNSPSGLGGIGNIYNRMT
PSLTLGTGSWGENSISHNVTDYDLLNVKTIAKRRNNMQWIKLPRIYFERDSVRYLKDMPG
IKRVFIVTGPSIQAHGYVDVVTDQLRLRENDVQYLVFSDVEADPSTTTVEKGVALMKSFK
PDTIIALGGGSPLDAAKGMWMFYEDENASFFGAKQKFLNIRKRAYRFDKPKKAQMVAIPT
TSGTGSEVTPFAVITDAKTHVKYPLADYALTPDVAIVDPQFVDTVPKGNIAASGLDVLCH
SIESYVSSMASDYTRPLSLQAIKLVFDNLTASYNGDEEARAAMHNASTLAGMAFGNAFLG
INHSIAHKLGGEFGLTHGIAIAITMPHVIKFNATLPKKFSTWPKYEAFRAADDYATIART
IGLTGDSNEELINKLCDKIKDLAHSLGVTLSLKAWGVDKAHFDKVVDHLAVLAYEDQCTT
ANPQEPLIADLKQIMIDEYDGKGVETK
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcaaagtgaaccacaaaagatgacgaagaccgaaaagatggtggacgacctg
gtccaaaaggcccaccaagcgctcgatatcatgagcgaattcgaccaaaagaaggtggac
tacattacccaccaaatggtcgaggctggccaagataagcacatggaactggcgatcgaa
gccgtcaaggaaaccggtcgtgggatcgtggaagataaggcgatcaagaatatgtttgcg
actgaagaaatttggcacaacattcgcaaggaccacaccgttggggtaattgaagacaac
aaggccgatgagttaattacggttgccgaaccgctcggggtcttagccggaatcacgccg
gttaccaacccaacctcaacgacgctgtttaaggccatcattgccatgaagacccgcaac
ccaatcatcttctccttccacccacaagccttggaatgctcccgtcacgccgctcgaatc
gtgcgggatgccgccatcgccgccggggcaccggaaggagcgatccaatggattgacgaa
ccaagtcgggaatcttcaaccgcattgatcaacaaccctggaattgcctgtaccttagct
actgggggccccggcatggtgagggctgcttactccaccgggaagccagccctgggggtg
ggacctggtaacggtccggtttatatcgaaaaaaccgctaagattgcccgggccgtcaac
gacattgttttatccaagacttttgataacgggatgatctgtgccacggaaaactctgcc
gttattgaccacgaaatttacgatgaagtgaaggccgacttgaaggcgaaccgcgtctac
ttcgttccccaaaatgaacacgctaagttgcgcaaggtaatgtttaacgaacaaaccggt
ggggttaacggcccgatcgccggtaagtccgctatgcaaattgccgaaatggccgacatt
aaggtgccagaagacacccaggtcctggccgtcgaagttaatgccattggtaagcaagaa
ctactctccggtgaaaagctgagcccagttttgtcggtttacaaggccatggatcaacaa
gatgcctttgataagtgtgaagccctacttaactacgggggactgggccacacggctgcc
attcaaacccaaaacatggacctagctcgtgaatttggggtggcgatgaaggcctcacgg
atcatcgttaactccccgtccggactcggtgggattgggaacatctacaaccggatgacc
ccatctttgaccctagggactggttcatggggggagaactcgatttcccacaacgtgacc
gattacgatttgctaaacgtaaagacaattgccaagaggcggaataacatgcaatggatt
aaattaccacggatctacttcgaacgcgattctgttcgttacctcaaggatatgccaggg
atcaagcgggtcttcatcgttactggcccatcaattcaagcccacggctacgttgatgtg
gtgactgaccaattgaggctgcgggaaaacgatgtccaatacctggtcttctccgatgtc
gaagccgatccatccacgacgacggttgaaaaaggggtcgccctgatgaagagcttcaag
ccggacacgattatcgctttgggtgggggttcgccgctggacgccgccaaggggatgtgg
atgttctacgaggacgaaaatgcttccttcttcggggcaaagcaaaagttcttgaacatc
cgtaagcgggcctaccgcttcgacaagccgaagaaggcccaaatggtggcgatcccaacc
acttccgggaccgggtccgaagtaacgccgttcgccgtgattacggacgccaagacccac
gtgaagtacccactggccgattacgctttgacgccggacgtggccatcgttgacccccag
tttgtggacacggtaccaaagggcaacatcgccgcttccggtttggacgtcttgtgccac
tcgattgaatcctacgtttccagcatggcctccgattacacccggccgctgtccttgcaa
gccatcaagttagtctttgacaacttaaccgcttcgtacaatggggatgaagaagcccgg
gctgccatgcacaacgcttcgaccttagccgggatggcctttgggaacgccttcttaggg
atcaaccactcaatcgcccacaagctgggtggtgagtttggcctgacccacgggatcgcc
atcgccatcacgatgccacacgtcatcaagtttaacgccaccctgccaaagaagtttagc
acgtggccgaagtacgaagccttccgggccgccgatgactacgcaacgatcgcccgcacg
atcggtttgaccggcgactccaacgaagagttgatcaacaagctctgcgacaagatcaag
gacttggcccactcgctgggtgtaaccctgagcttgaaggcctggggcgtcgacaaggct
cacttcgataaggtggttgaccacctagccgtcttagcctacgaagatcaatgtacgacg
gctaacccgcaagaaccactgattgccgacctgaagcaaatcatgatcgacgaatacgac
gggaagggcgtcgaaaccaagtaa

DBGET integrated database retrieval system