KEGG   Lactobacillus fermentum IFO 3956: LAF_0285Help
Entry
LAF_0285          CDS       T00699                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LAF_0285
DNA repair and recombination proteins [BR:lfe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     LAF_0285
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LAF_0285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
355588..356187
Genome map
AA seq 199 aa AA seqDB search
MQYPEPIARLIDSYMKLPGIGEKSATRLAFYTLGMSDADVDNFAKSLRAVKRDLHYCSVC
GNITEDDPCPICKDKTRDQSRVLVVERSRDIMAMERMKEYHGLYHVLHGTISPSEGTGPQ
DINLESLLKRLEAHKEIQEVIVATNASLDGETTAQYLAHLIKPAGIKVTRLAHGLSAGAD
IDYTDEVTLFRAVQGRTEM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacccagaaccgattgcccgtttaatcgatagctacatgaagctgccgggaatc
ggggagaaatctgccacccggctcgccttttacaccttgggcatgtccgatgcggacgtg
gataactttgccaagtcgttaagggccgttaagcgcgacttgcactactgcagcgtgtgc
gggaacattaccgaagacgacccgtgtcccatttgtaaggataagacccgtgaccaaagc
cgggtcttggtggtggaacggtccagagacattatggccatggaacggatgaaggaatac
cacggcctttaccacgtcttacacgggacgatatcgccaagcgaagggacgggcccccaa
gacattaacttggagagcctcttaaagcgccttgaagcgcataaggaaatccaagaggtg
atcgtggccaccaacgcttctttagacggggaaaccaccgcccagtacttggcccacttg
attaagccagccgggatcaaagtaacccgcttagcccatggtttatcagcgggggcggac
attgattacactgatgaagtgaccctcttccgggcggttcaagggcgaacggagatgtaa

DBGET integrated database retrieval system