KEGG   Lactobacillus fermentum IFO 3956: LAF_0340Help
Entry
LAF_0340          CDS       T00699                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LAF_0340
   00052 Galactose metabolism
    LAF_0340
   00500 Starch and sucrose metabolism
    LAF_0340
   00520 Amino sugar and nucleotide sugar metabolism
    LAF_0340
Enzymes [BR:lfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LAF_0340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
408741..409652
Genome map
AA seq 303 aa AA seqDB search
MKQVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEARKSGIEDIVVVDGKN
KRSIEDHFDSNPELEDNLRDKHKDEMLKLVQETTDINIYFIRQSHPRGLGDAVLTARDFI
GDEPFVVMLGDDLNNINGDAEPLTKELINSYEETGASTLAVMRVPHEDTAKYGVINPSKE
VMPGLYNVTSFVEKPEPKDAPSDLAIIGRYVFTPEIFDVLAKTKPGKGNEIQLTDAINTL
NKTQRVFAHEYKGHRYDVGNKFGWIETNIEYGLKHPETKDELREYIKDLGVKFAAEDKKK
PAK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagtaagaaaagcaattattccggcagccggcttagggacgcgctttttgcca
gccaccaaggccttagcaaaggaaatgttaccaatcgtcgacaagccaaccatccaattc
atcgttgaagaagcccgtaagtccgggattgaagacatcgtggtggttgatgggaagaac
aagcgctccatcgaagaccacttcgactctaacccagaactggaagataacctgcgcgat
aagcacaaggatgagatgctcaagctggttcaagaaaccactgacattaacatctacttc
atccgccaatcccacccacgtggtttgggggacgccgtgttgaccgcccgtgactttatt
ggcgacgaaccgttcgtggtaatgcttggtgacgacttgaacaacattaacggcgatgcc
gaaccgttgaccaaggaattaatcaactcttacgaagaaaccggtgcatcaaccttagca
gttatgcgggtgccgcacgaagacaccgccaagtacggggtcatcaacccaagcaaggaa
gtaatgccgggtctttacaacgttacctccttcgtggaaaagccggaaccaaaggatgcg
ccaagtgacttggccatcatcggccgctacgtcttcacgccagaaatttttgatgtactg
gccaagaccaagccgggtaagggtaacgaaattcaactgactgatgccatcaacacctta
aacaagacgcaacgggtctttgcccacgaatacaagggtcaccgttacgacgtcggcaac
aagtttggctggattgaaactaacattgaatacggcctcaagcacccggaaaccaaggat
gaactccgtgagtacatcaaggatttgggcgttaagttcgccgctgaagacaagaagaag
ccagcaaaataa

DBGET integrated database retrieval system