KEGG   Lactobacillus fermentum IFO 3956: LAF_0402Help
Entry
LAF_0402          CDS       T00699                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LAF_0402
   00051 Fructose and mannose metabolism
    LAF_0402
Enzymes [BR:lfe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     LAF_0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
480153..481502
Genome map
AA seq 449 aa AA seqDB search
MSDLWQGIDKISYVGNKGSLKSGLGFQYYNPEEEILGKKMKDWLRFSVAYWHTFDQRLVD
PFGDGTATRPYDKYTDPMDNALAKVDYAFEFYQKLGVDYLCFHDRDLAPEGDTLRESNAN
LDKVIDKIVENQKATGMKVLWNTSNLFTNPRFLSGAGTAPSSKIYAYACAQLKHSLEVGK
RVGAENYVFWGGREGYESLWNTEMKREQAHIAKMFHLAKDYADEIGFDAQMLLEPKPKEP
TTHQYDFDAATTIAFMKEYGLDKDFKLNLEGNHANLAGHTYQHEIRVAREAGMLGSLDAN
QGDKLIGWDIDEFPSNLYETTAAMWEVVENGQIGPRGGLNFDAKPRRTSWQAEDLFYSHI
VGMDSFAAGLRVAAAMKEDGFLDDVLKTRYASWDEGLGKDIEDGKEDFKSLEEKLLDTPQ
AELRAATQSDHLEQIKDTINHYIIQTLAK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttatggcaaggtatcgataagattagttacgttggtaataaaggtagtctt
aagtctggtttaggtttccaatactacaacccggaagaagaaatcctgggtaagaagatg
aaggattggctgcgcttctcagttgcctactggcacacctttgaccaacgcttggtcgac
ccgtttggtgatgggactgctacccgcccatacgacaagtacacggatccaatggataac
gccttagcaaaggttgattacgcctttgaattttaccaaaagctcggcgttgattacctt
tgtttccacgaccgtgacttggcgccggagggtgacaccctgcgggaatccaacgccaac
ctagataaggtaattgacaagatcgtggaaaaccaaaaggcaaccgggatgaaggtgctg
tggaacacttccaacctctttaccaacccacgtttcttatccggggctgggacggcgcca
tcgtcaaagatttatgcctacgcttgtgcccagttgaagcacagtctggaagttgggaag
cgggttggcgctgagaactacgtcttctggggtggtcgtgaaggttacgaatccctttgg
aacaccgaaatgaagcgtgagcaagcccacattgctaagatgttccacctggccaaggat
tacgctgatgaaattggttttgatgctcagatgcttctggaaccaaagccaaaggaacca
acgacgcaccaatacgacttcgatgccgccacgacgattgccttcatgaaggaatatggc
ttagacaaggacttcaagctaaacttggaaggcaaccacgcaaacttagccggtcacact
taccagcacgaaatccgcgttgctagagaagccgggatgctgggctccctggatgctaac
caaggtgataagctaattggttgggacattgatgagttcccgtccaacctttacgaaacg
acggccgcaatgtgggaagtcgttgaaaacggtcaaattgggccacgcggtggtttgaac
tttgacgccaagccacgccggacctcttggcaagcagaagacctcttctacagccacatt
gtcgggatggattcctttgcagccggtctgcgagtggcagcagctatgaaggaagacggc
ttcttggatgacgttttgaagacccgttatgcttcatgggacgaaggtctgggcaaggac
atcgaagacggcaaggaagacttcaagagcctagaagaaaagcttttggacaccccacaa
gctgaattgcgggcggcaactcaatctgaccaccttgaacagatcaaggacacgattaac
cactacatcatccaaaccttagcaaagtaa

DBGET integrated database retrieval system