KEGG   Lactobacillus fermentum IFO 3956: LAF_0402Help
Entry
LAF_0402          CDS       T00699                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:lfe00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lfe00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
480153..481502
Genome map
AA seq 449 aa AA seqDB search
MSDLWQGIDKISYVGNKGSLKSGLGFQYYNPEEEILGKKMKDWLRFSVAYWHTFDQRLVD
PFGDGTATRPYDKYTDPMDNALAKVDYAFEFYQKLGVDYLCFHDRDLAPEGDTLRESNAN
LDKVIDKIVENQKATGMKVLWNTSNLFTNPRFLSGAGTAPSSKIYAYACAQLKHSLEVGK
RVGAENYVFWGGREGYESLWNTEMKREQAHIAKMFHLAKDYADEIGFDAQMLLEPKPKEP
TTHQYDFDAATTIAFMKEYGLDKDFKLNLEGNHANLAGHTYQHEIRVAREAGMLGSLDAN
QGDKLIGWDIDEFPSNLYETTAAMWEVVENGQIGPRGGLNFDAKPRRTSWQAEDLFYSHI
VGMDSFAAGLRVAAAMKEDGFLDDVLKTRYASWDEGLGKDIEDGKEDFKSLEEKLLDTPQ
AELRAATQSDHLEQIKDTINHYIIQTLAK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttatggcaaggtatcgataagattagttacgttggtaataaaggtagtctt
aagtctggtttaggtttccaatactacaacccggaagaagaaatcctgggtaagaagatg
aaggattggctgcgcttctcagttgcctactggcacacctttgaccaacgcttggtcgac
ccgtttggtgatgggactgctacccgcccatacgacaagtacacggatccaatggataac
gccttagcaaaggttgattacgcctttgaattttaccaaaagctcggcgttgattacctt
tgtttccacgaccgtgacttggcgccggagggtgacaccctgcgggaatccaacgccaac
ctagataaggtaattgacaagatcgtggaaaaccaaaaggcaaccgggatgaaggtgctg
tggaacacttccaacctctttaccaacccacgtttcttatccggggctgggacggcgcca
tcgtcaaagatttatgcctacgcttgtgcccagttgaagcacagtctggaagttgggaag
cgggttggcgctgagaactacgtcttctggggtggtcgtgaaggttacgaatccctttgg
aacaccgaaatgaagcgtgagcaagcccacattgctaagatgttccacctggccaaggat
tacgctgatgaaattggttttgatgctcagatgcttctggaaccaaagccaaaggaacca
acgacgcaccaatacgacttcgatgccgccacgacgattgccttcatgaaggaatatggc
ttagacaaggacttcaagctaaacttggaaggcaaccacgcaaacttagccggtcacact
taccagcacgaaatccgcgttgctagagaagccgggatgctgggctccctggatgctaac
caaggtgataagctaattggttgggacattgatgagttcccgtccaacctttacgaaacg
acggccgcaatgtgggaagtcgttgaaaacggtcaaattgggccacgcggtggtttgaac
tttgacgccaagccacgccggacctcttggcaagcagaagacctcttctacagccacatt
gtcgggatggattcctttgcagccggtctgcgagtggcagcagctatgaaggaagacggc
ttcttggatgacgttttgaagacccgttatgcttcatgggacgaaggtctgggcaaggac
atcgaagacggcaaggaagacttcaagagcctagaagaaaagcttttggacaccccacaa
gctgaattgcgggcggcaactcaatctgaccaccttgaacagatcaaggacacgattaac
cactacatcatccaaaccttagcaaagtaa

DBGET integrated database retrieval system