KEGG   Lactobacillus fermentum IFO 3956: LAF_0415Help
Entry
LAF_0415          CDS       T00699                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:lfe01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lfe01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lfe00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lfe00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:lfe00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
495379..496155
Genome map
AA seq 258 aa AA seqDB search
MRKPFVVANWKMHKSVDEALDFIRSLQGRLPDADLVECGVAANFLALYPMLQEVKGQPLE
IISQNAYAEYEGAYTGEVSPKALADAGINYALLGHIERRKLFNETDDLVNRKVIATLQAG
MTPIICTDETMIQKEFSGSVHYVFEQLINVLRGVSFDQVKNIIISYEPSWAVGVGQHANP
NLAEEGCRLIRQTIADSYSYEVADKIRILYGGSVNPENIKQIMNKPDIDGVLIGRASLDT
DNFLSMINTVVELYKGAK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccatttgtggtcgcgaattggaaaatgcacaagagcgttgatgaagcgtta
gactttatccggagcttgcaaggccggcttcccgatgccgacttagtcgaatgcggggtc
gccgccaatttcttagccctgtacccaatgttacaagaggtcaagggccaaccgctggaa
attatttcgcaaaacgcctatgccgaatacgagggggcctacaccggtgaggtaagtcct
aaggccctggccgacgccggaattaattatgccttgttaggccacattgaacggcgcaag
ctttttaatgaaacggacgatttggttaaccgaaaggtaatcgccaccttgcaggccggg
atgaccccgattatttgtaccgatgagacgatgattcaaaaagagtttagtggtagcgtc
cactacgtctttgaacagttaatcaacgtcttgcggggcgtttccttcgaccaggtaaaa
aacattatcatttcttacgaaccgagctgggcggtcggggttggtcaacacgccaacccg
aacctggccgaagaagggtgccgcctgattcggcaaacgatcgccgactcgtattcttac
gaggtggccgataagatccgaatcctctacggtgggagcgttaatcccgaaaacattaag
caaatcatgaacaaaccggacattgatggggtcttaattggccgggcaagcctcgacacc
gataacttcttgtcgatgatcaatacggtagtcgaactttataagggtgctaaatag

DBGET integrated database retrieval system