KEGG   Lactobacillus fermentum IFO 3956: LAF_0515Help
Entry
LAF_0515          CDS       T00699                                 

Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lfe03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
612683..613285
Genome map
AA seq 200 aa AA seqDB search
MFEYLTGLITMVSPDFIVVDVNGVGYRVAVANPYAYQEDDQQAVQVFIYQAVKEDAITLF
GFATQAEKRLFTQLIGVSGIGPKSALAILATPDHQGLIDAIQNGDDKYLSKFPGIGKKTA
SRIIIELKDKVVAVQDEVQLDFTAPGPLGPSAALQDALAALESLGYTTKQVERVQKQLEG
LQGELSTNDYLSQGLKLLSR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatatttaaccggtttaattacaatggtcagccccgattttatcgtggttgac
gtcaacggggtcggctaccgggtggcggtggccaacccctacgcctaccaagaagacgat
caacaggccgtccaggtctttatttaccaagcggtcaaagaagacgccattaccctcttt
gggttcgcaacccaggccgaaaagcgcctgttcacccagctaattggggtctccgggatt
gggccgaagagtgccctggcaatcttagccactcccgaccaccaggggctaatcgacgcg
attcaaaacggcgacgataagtacctgagcaagttcccggggattggtaagaagacggcc
tcgcggatcattattgagttaaaggacaaggtcgtggcggttcaagacgaggtccaactc
gacttcacggccccagggccactgggtccgtccgcggcactccaagacgccttggcagcc
ctggagtcgctagggtacacgaccaagcaagtcgaacgggttcaaaagcaattggaaggc
ttgcaaggcgagctgtccaccaacgactacctcagccagggcctgaagttgttgagcaga
taa

DBGET integrated database retrieval system