KEGG   Lactobacillus fermentum IFO 3956: LAF_0593Help
Entry
LAF_0593          CDS       T00699                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lfe03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
695353..697899
Genome map
AA seq 848 aa AA seqDB search
MAYRDYTQPVIHDEKVQETGPTHFSGRVRKVIFSNPPFAILAVTVLKADFEWDTEEITVK
GDVGQVNEGDEFEFEGQVVNNPRYGFEFDFSGFVHQLPHDAKELAAFLKKNNVAVSDEKK
VAKAIDDALGEKAMSTLIGDADAIEVVSGLSQKDIATLKTFFNRLVKDDEASKANRQLMM
LDFSAWMIRRLQEFYQRRLLKILEEDIYQVVADYEQLGISFRPVDEAARQYQDVAFDDPR
RIDGALLFAAQILIRENSGSYVAPQLLLNRASQLLNQGATVSQDTLAARLGILLTQKKLY
HVPERGIYPALFFHAENLIASQLHQMMAAAQPVSAKRQKLIEKIVDQVAKEQKITYDDQQ
KAAIKQALEAPVLLLTGGPGTGKTTILNGIVRAYRRLLKEDGQKLHAWSDGEPIQLVAPT
GRAAKQARQAITGEGVAASTIHHFLSIATDNDAARLIEKPAPLENAGQMLVVDEMSMTST
LLMGGLMAVIPTNIHLVLVGDFDQLPSVGPGQVFRDLLESNCLPQVRLERIYRQDADSSL
IPLAQRINKGDVDEDFIAPTPKTRYPKRIFVTTAARDVPARIGQLVDAYLGGHDLDIQDI
QILTPLRHHRDLINSYLQDHLNPASLNQATYRLRSRELRVGDKVMQTTNDSDAEVYNGDI
GIIKSIAGKDKHVVNGDRLAKKEKVHLKVTVDFAGHLVKYDDPTALANLELAYAMTIHKA
QGSQAPVVIVTLLSEFFPTNPQAGSIIQRNLLYTAVTRSSRALVMVGDAPAFVRCSKTPV
VDRPTSLKQRLKLVWQAAQQDPDSPADEKAQTPVQEEQPADHLTPAMVEDERVDPLIGMD
GLSPADFA
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atggcgtaccgggattatacccagccggtaattcatgacgaaaaggtccaagaaacggga
ccaacgcatttttcggggcgggtacgaaaagttatcttttctaacccgccctttgctatt
ttagcggtgacggtgttaaaggctgactttgagtgggacaccgaagaaatcaccgttaag
ggtgacgttggtcaagttaacgagggcgatgagtttgaatttgagggtcaggttgtcaac
aacccgcgctacggctttgagtttgatttttcgggctttgtccaccagctgcctcacgac
gccaaggagctggccgcctttttaaagaagaacaacgtggcggtcagtgatgagaaaaag
gtggccaaggccattgatgacgccttaggcgaaaaggccatgagcaccctgattggcgac
gccgacgcaatcgaagtggtgtccgggttgagtcaaaaagacatcgcgaccttaaagacc
tttttcaaccggttggtcaaagatgacgaggccagcaaggccaaccgccagttgatgatg
ctcgatttctcggcctggatgatccgccgcttgcaggaattctaccaacggcggttgctt
aaaatcctcgaagaagacatttaccaagtggtagccgattatgagcagttggggattagt
tttcgcccggtggatgaggcggcacgccagtatcaagacgtggccttcgatgatccccgc
cgcatcgatggggccctcctctttgccgcccaaattctgattcgggaaaattccggctcg
tacgtcgccccgcaattactgttgaaccgggctagccaactccttaaccagggcgccacc
gtcagccaggataccctggcggcgcgtttgggaattttactgacccaaaagaagctttac
cacgtgcccgagcggggaatctacccggccctgttctttcacgccgaaaatttaattgcc
agtcagcttcaccagatgatggcggcggcccagccggtcagcgccaagcggcaaaagctg
attgaaaagatagttgatcaggtggccaaggaacaaaaaatcacttacgacgaccagcaa
aaggcggcgattaaacaggccttagaagcaccggtgctgctcttgaccgggggaccgggg
accgggaagacgacgattctaaacgggatcgtgcgggcataccggcgcctgttaaaagag
gacggccaaaagctccacgcttggagcgatggggaaccaattcagttagttgcccccacc
gggcgggcggctaagcaagcccgccaggcgatcacgggtgagggcgttgccgcgtcaacc
atccaccacttcttgagcattgcaaccgataacgatgccgcccgtttgattgaaaaaccg
gcgcccctagaaaatgccggtcagatgctggtggttgacgaaatgtcgatgacctccacc
ctcttgatgggggggctaatggcggtgatcccgaccaacatccacttagtgttagtcggt
gacttcgatcagctgccgtcggtgggaccggggcaggtgttccgggacttgctcgaatct
aattgcttaccgcaagtccgcttggaacggatttaccgccaggacgccgattcctctttg
atcccgttagcccagcggatcaacaagggggacgttgacgaggacttcattgcccccacc
ccaaagactaggtaccccaagcgaatctttgtgaccactgccgctcgcgacgttccggcc
cggattggtcagctagtcgacgcctacttgggtggtcatgacttggatattcaagatatt
cagatcttaaccccgctacggcaccaccgcgacctgattaatagctacttgcaagaccac
ctgaatccggccagcttaaaccaggccacttaccggttacgaagccgggagctacgggtg
ggcgacaaggtaatgcagacaacgaacgactccgacgccgaggtttataacggtgacatc
gggatcatcaagtcgattgccgggaaagataagcacgtcgttaacggcgatcggctcgcc
aaaaaggagaaggtgcacctgaaggtcacggtcgactttgctggccacctggttaaatac
gatgaccccaccgccctggctaacttagaactggcctacgcgatgacgattcacaaggcc
caggggagtcaggcgccggtcgtgattgtgaccttgctgtcggagtttttcccgactaac
ccccaggctggttcaatcatccaacgtaacctcttgtacacggcagtgacccggtcgtcg
cgggctctggtgatggtgggtgacgccccggccttcgtgcgttgctctaagacgccggtg
gtggaccgccccacctcgctcaagcagcgactgaagttggtttggcaagcagcccagcag
gatccagactccccggcagacgagaaagcccagacgccggttcaagaagaacaaccagcg
gatcacttgacgccggcaatggtggaagacgaacgggtggacccgctgatcggcatggat
ggattaagtccggccgactttgcctaa

DBGET integrated database retrieval system