KEGG   Lactobacillus fermentum IFO 3956: LAF_0757Help
Entry
LAF_0757          CDS       T00699                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LAF_0757 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    LAF_0757 (hisD)
Enzymes [BR:lfe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     LAF_0757 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
892558..893841
Genome map
AA seq 427 aa AA seqDB search
MKIYQKNLTEMKQIVDDYTSATVDPQIVATVAEIIQTVRQEGDAALRNYGAQFDKVDVKE
FAVPQTKLEAAYQTLPSNLKDALTTAKANITSFHQQEIENGFADLTTPGVVRGQKVTPLA
RVGLYVPGGTAAYPSTILMNAIPAKLAGVGKLVMVTPPQREGISQTVLAAAYLAGVDAVY
QVGGAQAIAALAYGTESIPQVDKIVGPGNIFVATAKQQVFGQVAIDMVAGPSEIGIIADS
NANPDEVAADLLSQAEHDRRARAMLVTDSVELAEAVSAAVDQQLKTLPRQEIAQEAIANR
SFIAVMADQDEMFELMNSIAPEHLELQVQDPITAMGKVQNAGSVFLGRYASEPLGDYLAG
PNHVLPTGGTARFASPLGVYDFVKRTQFLQYTEAALAGVVQEVADLARAEGLEAHARAVE
ARFKEGD
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaagatttaccaaaagaacctcaccgaaatgaagcaaatcgtggacgactacaccagc
gccaccgtcgacccccagattgtcgcaacggttgccgagatcatccaaaccgtccgccaa
gaaggcgacgccgccctccgcaattacggcgcccagtttgataaggtcgacgttaaagag
tttgcggtcccacaaaccaaactggaggcggcctaccaaaccctgccgtcaaacctcaag
gacgccctgaccaccgctaaggccaacatcactagcttccaccaacaagaaattgagaac
ggctttgccgatttaaccacgcccggggtggtgcggggccaaaaggtgacccccttagcc
cgggtgggcctctacgtgccggggggcaccgccgcgtacccgtcgacgatcctgatgaac
gcgattcccgccaagctagcgggggtcggtaagttggtgatggtcacgccgccgcaaagg
gaggggatctcccagacggtgctggccgccgcctacctggccggcgtcgacgccgtttac
caagtcgggggtgcccaagcgatcgccgccttagcctacgggaccgaaagcatcccgcaa
gtcgataagatcgttggcccggggaacatcttcgtcgccaccgctaagcaacaggttttt
ggccaggtcgccatcgacatggtggccgggccgtcggaaatcgggatcatcgcggacagc
aacgccaacccggacgaagtggccgccgacctcttatcgcaggccgaacacgaccggcgc
gcccgggcgatgctagtcaccgacagcgtggaactggccgaggccgtttccgccgccgtt
gaccagcagttaaaaaccctgccacgtcaggaaattgcccaagaagcgatcgccaaccgt
agcttcattgccgtaatggcggaccaagacgaaatgtttgaactgatgaattcgattgcc
ccggagcacttggaactccaggtccaggacccgatcaccgcgatgggcaaggtgcaaaac
gccggctcggtcttcttgggccgttacgcctccgagccgctcggcgattacctagccggg
ccaaaccacgtcttgccaaccgggggaaccgcccgctttgcctcaccactaggggtgtac
gatttcgttaagcggacccagttcttgcaatacaccgaagccgccctggccggggtggtg
caagaagtcgccgacttggcccgggccgaggggctggaggcccacgcccgcgccgttgaa
gcccgttttaaggagggagattaa

DBGET integrated database retrieval system