KEGG   Lactobacillus fermentum IFO 3956: LAF_0767Help
Entry
LAF_0767          CDS       T00699                                 

Definition
(GenBank) phosphoglycerate mutase
Organism
lfe  Lactobacillus fermentum IFO 3956
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAG27103
UniProt: B2GBS1
Position
complement(901187..901810)
Genome map
AA seq 207 aa AA seqDB search
MTKLYIIRHGQTAANVAGLKQGTIDDERTYLSETGIAQAKELAGALDLTGFAALYHSPLH
RTVETAQIVNQTAHLPMVADDRLLEISYGDWDGQLNADLMAKYPDLFDPLINDVRAAYAP
VANGESFASVEARVQAFTEEVAKAHPDERVAVVTHGFTVRSFAINATQSHDLTILEPANC
SVTKILVDPTSGDQHLVYYNRSASPAF
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgactaaactttacattatccgccacgggcaaacggctgccaacgtcgccgggctcaag
caggggacgatcgacgacgagcgtacctacctgtctgaaacggggatcgcccaggccaag
gaactggccggcgccttggacctgactggttttgccgccctctaccactcccctctgcac
cggacggttgaaacggcgcagattgttaaccaaacggcccacctgccaatggtcgccgac
gaccgcttgctcgaaatttcctacggcgattgggacggccagttaaacgccgacctgatg
gctaagtacccggacctctttgatcccctaatcaacgacgtccgggccgcctacgccccg
gtcgctaacggggaaagctttgccagcgtcgaagcccgggtgcaagccttcaccgaagag
gtcgctaaggcccaccctgacgaacgagtcgccgtcgtcacccacggcttcaccgtccgc
tcctttgccattaacgccacccagtcgcacgacctgacgattttagaacccgccaactgc
agcgtcaccaaaatcctagttgaccccactagcggcgaccagcacctagtttactataac
cgcagcgccagcccggccttttag

DBGET integrated database retrieval system