KEGG   Lactobacillus fermentum IFO 3956: LAF_0767Help
Entry
LAF_0767          CDS       T00699                                 

Definition
phosphoglycerate mutase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LAF_0767
   01230 Biosynthesis of amino acids
    LAF_0767
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAF_0767
  Energy metabolism
   00680 Methane metabolism
    LAF_0767
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LAF_0767
Enzymes [BR:lfe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     LAF_0767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(901187..901810)
Genome map
AA seq 207 aa AA seqDB search
MTKLYIIRHGQTAANVAGLKQGTIDDERTYLSETGIAQAKELAGALDLTGFAALYHSPLH
RTVETAQIVNQTAHLPMVADDRLLEISYGDWDGQLNADLMAKYPDLFDPLINDVRAAYAP
VANGESFASVEARVQAFTEEVAKAHPDERVAVVTHGFTVRSFAINATQSHDLTILEPANC
SVTKILVDPTSGDQHLVYYNRSASPAF
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgactaaactttacattatccgccacgggcaaacggctgccaacgtcgccgggctcaag
caggggacgatcgacgacgagcgtacctacctgtctgaaacggggatcgcccaggccaag
gaactggccggcgccttggacctgactggttttgccgccctctaccactcccctctgcac
cggacggttgaaacggcgcagattgttaaccaaacggcccacctgccaatggtcgccgac
gaccgcttgctcgaaatttcctacggcgattgggacggccagttaaacgccgacctgatg
gctaagtacccggacctctttgatcccctaatcaacgacgtccgggccgcctacgccccg
gtcgctaacggggaaagctttgccagcgtcgaagcccgggtgcaagccttcaccgaagag
gtcgctaaggcccaccctgacgaacgagtcgccgtcgtcacccacggcttcaccgtccgc
tcctttgccattaacgccacccagtcgcacgacctgacgattttagaacccgccaactgc
agcgtcaccaaaatcctagttgaccccactagcggcgaccagcacctagtttactataac
cgcagcgccagcccggccttttag

DBGET integrated database retrieval system