KEGG   Lactobacillus fermentum IFO 3956: LAF_0970Help
Entry
LAF_0970          CDS       T00699                                 

Definition
O-succinylbenzoate-CoA ligase
Orthology
K01911  
O-succinylbenzoic acid--CoA ligase [EC:6.2.1.26]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Ubiquinone and other terpenoid-quinone biosynthesis [PATH:lfe00130]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1122048..1123472
Genome map
AA seq 474 aa AA seqDB search
MEIPNWLLKQASLNPNRVAVNDGTTAYTFAQLVPLVAHRAGQIQAQTDQPRVGVMTHNNL
AGYLAALGVLAADKTIVWLNWRLAPEELSRQIGDAGLDLVLVDDQLADRYYGGHRVLCSE
LTAGTAPAAVLTPTVDLDAVASIMYTSGTTGQPKGVLQTYGNHLASAISSSLNLGVLPND
LWLCVAPIFHISGFSILMRGLIYGMGVRLVNHFDAQVVNQILEDEPVTIISAVPYMLKKM
LEDVQANDHCYSSAFRLVLLGGGTIDRATLNACEESGLPVVQCYGMTETCSQFVALSAEE
APYHLGSVGKPLFTTQLRLVGEHHEIEIQTPALTPGYLNQPAKFAAKHDGDWYRTGDVGH
FDEDGFLYVDGRLDEMIISGGENIFPAEVENVLRQYPGIQEIAVVGRNDQQWGAVPVAVV
VSKQPVDFQQLEAFGREHLAHYKVPKVYLQTDALPKNASGKVQKFRLQDLVANA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggagattccaaattggctcctcaaacaggcttcgctaaaccctaaccgggtggcggtt
aacgacggtaccaccgcctacacctttgcccagctggttcccctggtcgcccaccgtgct
ggccagattcaagcgcagacggaccagccccgggttggggtgatgacccacaataacctg
gctggttacttagccgccctaggggtcttagccgccgacaagaccatcgtttggctaaat
tggcgcctcgcccctgaagaactgagtcgccaaatcggcgacgcggggctcgacctagtc
ttagtcgatgaccaactagccgaccgctattacggtgggcaccgggtcctctgttcggaa
ttgacagccggcactgccccggcggcagtgttgacgccgacggttgacctagacgccgtg
gcctcgatcatgtacacctcgggaaccaccggtcagccaaagggcgtcttgcaaacctac
ggcaaccacttggcctccgccatttcgtcatctttgaacctcggggtgttgccaaacgac
ctctggttgtgcgtcgcccccatcttccacatttcgggcttttcaattctaatgcggggc
ctgatttacgggatgggcgttcgcctagtcaaccatttcgatgcgcaagtggtcaaccaa
atcctggaggacgaaccggttacgatcatttcggccgttccctacatgctaaagaagatg
ctcgaagacgtccaagcaaatgaccactgttactcatcggcctttcgcctggtgctactc
ggcggtgggacgattgaccgggcgacccttaacgcctgcgaagaaagtgggctgccggtt
gtccagtgttacgggatgaccgaaacttgctcgcagttcgttgccctctcggctgaagag
gcgccttaccaccttggttcggtcggtaagcccctgtttaccacccagctgcgtttggtg
ggtgagcatcacgaaatcgagatccagaccccggccttaaccccgggttacttaaaccaa
ccggccaagtttgcggctaagcacgatggcgactggtaccgaaccggcgacgtcggccac
tttgatgaagacggtttcttgtacgtcgacggacggttagatgaaatgatcatctccggg
ggcgaaaacattttccccgccgaggtggaaaacgtcttgcgccagtacccaggcatccaa
gaaattgccgtggtcggccgtaatgatcaacagtggggcgccgttcccgtggccgtggtc
gtcagcaaacaacccgtcgactttcagcagttggaggccttcgggcgtgaacacctggcc
cactataaggtacccaaggtctacttgcaaacagacgccctaccgaaaaacgccagcggc
aaggtccaaaagtttcgcttacaagacctggtcgctaacgcttag

DBGET integrated database retrieval system