KEGG   Lactobacillus fermentum IFO 3956: LAF_0970Help
Entry
LAF_0970          CDS       T00699                                 

Definition
(GenBank) O-succinylbenzoate-CoA ligase
  KO
K01911  O-succinylbenzoic acid---CoA ligase [EC:6.2.1.26]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
lfe00130  Ubiquinone and other terpenoid-quinone biosynthesis
lfe01100  Metabolic pathways
lfe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    LAF_0970
Enzymes [BR:lfe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.26  o-succinylbenzoate---CoA ligase
     LAF_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: BAG27306
UniProt: B2GCC4
Position
1122048..1123472
Genome map
AA seq 474 aa AA seqDB search
MEIPNWLLKQASLNPNRVAVNDGTTAYTFAQLVPLVAHRAGQIQAQTDQPRVGVMTHNNL
AGYLAALGVLAADKTIVWLNWRLAPEELSRQIGDAGLDLVLVDDQLADRYYGGHRVLCSE
LTAGTAPAAVLTPTVDLDAVASIMYTSGTTGQPKGVLQTYGNHLASAISSSLNLGVLPND
LWLCVAPIFHISGFSILMRGLIYGMGVRLVNHFDAQVVNQILEDEPVTIISAVPYMLKKM
LEDVQANDHCYSSAFRLVLLGGGTIDRATLNACEESGLPVVQCYGMTETCSQFVALSAEE
APYHLGSVGKPLFTTQLRLVGEHHEIEIQTPALTPGYLNQPAKFAAKHDGDWYRTGDVGH
FDEDGFLYVDGRLDEMIISGGENIFPAEVENVLRQYPGIQEIAVVGRNDQQWGAVPVAVV
VSKQPVDFQQLEAFGREHLAHYKVPKVYLQTDALPKNASGKVQKFRLQDLVANA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggagattccaaattggctcctcaaacaggcttcgctaaaccctaaccgggtggcggtt
aacgacggtaccaccgcctacacctttgcccagctggttcccctggtcgcccaccgtgct
ggccagattcaagcgcagacggaccagccccgggttggggtgatgacccacaataacctg
gctggttacttagccgccctaggggtcttagccgccgacaagaccatcgtttggctaaat
tggcgcctcgcccctgaagaactgagtcgccaaatcggcgacgcggggctcgacctagtc
ttagtcgatgaccaactagccgaccgctattacggtgggcaccgggtcctctgttcggaa
ttgacagccggcactgccccggcggcagtgttgacgccgacggttgacctagacgccgtg
gcctcgatcatgtacacctcgggaaccaccggtcagccaaagggcgtcttgcaaacctac
ggcaaccacttggcctccgccatttcgtcatctttgaacctcggggtgttgccaaacgac
ctctggttgtgcgtcgcccccatcttccacatttcgggcttttcaattctaatgcggggc
ctgatttacgggatgggcgttcgcctagtcaaccatttcgatgcgcaagtggtcaaccaa
atcctggaggacgaaccggttacgatcatttcggccgttccctacatgctaaagaagatg
ctcgaagacgtccaagcaaatgaccactgttactcatcggcctttcgcctggtgctactc
ggcggtgggacgattgaccgggcgacccttaacgcctgcgaagaaagtgggctgccggtt
gtccagtgttacgggatgaccgaaacttgctcgcagttcgttgccctctcggctgaagag
gcgccttaccaccttggttcggtcggtaagcccctgtttaccacccagctgcgtttggtg
ggtgagcatcacgaaatcgagatccagaccccggccttaaccccgggttacttaaaccaa
ccggccaagtttgcggctaagcacgatggcgactggtaccgaaccggcgacgtcggccac
tttgatgaagacggtttcttgtacgtcgacggacggttagatgaaatgatcatctccggg
ggcgaaaacattttccccgccgaggtggaaaacgtcttgcgccagtacccaggcatccaa
gaaattgccgtggtcggccgtaatgatcaacagtggggcgccgttcccgtggccgtggtc
gtcagcaaacaacccgtcgactttcagcagttggaggccttcgggcgtgaacacctggcc
cactataaggtacccaaggtctacttgcaaacagacgccctaccgaaaaacgccagcggc
aaggtccaaaagtttcgcttacaagacctggtcgctaacgcttag

DBGET integrated database retrieval system