KEGG   Lactobacillus fermentum IFO 3956: LAF_1015Help
Entry
LAF_1015          CDS       T00699                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lfe01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lfe00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1173330..1174481)
Genome map
AA seq 383 aa AA seqDB search
MDQAHAEEILKKVIAIPTVNDNEKEVADYLASLFAPYEDQGVTIEELAYSPGRSNLIVTI
GEGETTLGFSGHQDVVDPGDLADWDTDPFVPTIKEGRLIGRGASDMKSGLAAVVCAMLAM
LEEKKVPGKIKLIATVGEESGEYGAAQVTDAGLADDLSALVIAEPTDGMRQICYTSKGVV
DYHVTSKGIAAHSSRPHEGEDAIAHLLEFANEVQARLARLDKKDPVLGKLTSLITLIKGG
EQINSVPSQAELSGNIRTIPDYTNQVIFDVIDGLIAELNAKPGYQLSVDYIYPEEPMPGD
AHSPLVQLLQKVGLEVFGHTLTPVGGTGASDGSEFVRAKGDYPIVMVGPGSDSQHQPNEW
VSLAAYHQAIAFYQQFANEFFGK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggatcaagcgcacgcagaggagattttaaaaaaggtgatcgccattccaaccgtgaat
gataatgaaaaagaggtcgccgattacttagcgagtctctttgccccttacgaagatcag
ggggttacgattgaggagttggcatattcacccggccgcagcaatttgattgtcacgatt
ggggagggggagaccacgttaggcttttccgggcaccaagacgtcgtggaccccggtgac
ctggctgattgggacaccgacccctttgtaccgaccatcaaggaggggcgcctgattggg
cgtggtgcttcggacatgaagagtggcttggcggcggttgtctgcgcgatgctggccatg
ctggaagaaaagaaggtcccgggcaagatcaagttaatcgccacggtcggtgaagaatcc
ggcgaatacggggcggcgcaagtcaccgatgccgggctcgccgacgacctgagtgcgttg
gtgatcgccgaaccgaccgacggaatgcggcaaatttgctacaccagcaagggcgtcgtg
gactaccacgttacctccaagggaatcgccgcccactcttctaggccccacgagggtgaa
gatgcaatcgcccacctcttggagtttgccaatgaggttcaagcccgcctagcccgcttg
gataaaaaggatccggtactcgggaaacttaccagtttgattaccctgattaagggcggt
gaacagattaattccgtcccgtcccaagccgagctctctggcaacatccggacgatcccg
gattacactaaccaggtgatctttgatgtgatcgatggcttgatcgccgaattaaacgcc
aagccgggctaccagctcagcgtcgattacatttaccccgaggaaccgatgcccggcgac
gcccactccccgctggttcaactacttcaaaaggttggcctggaggtctttggtcacacc
ttgaccccggtcggtggaaccggggctagtgacggctccgagttcgttcgggccaagggt
gactacccaatcgtgatggtcggccccggcagtgacagtcagcaccagcctaacgaatgg
gtcagcctcgccgcctatcaccaggcgattgccttctaccaacagttcgctaatgaattc
ttcggcaagtaa

DBGET integrated database retrieval system