KEGG   Lactobacillus fermentum IFO 3956: LAF_1121Help
Entry
LAF_1121          CDS       T00699                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LAF_1121
Enzymes [BR:lfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LAF_1121
Exosome [BR:lfe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LAF_1121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1293528..1295039)
Genome map
AA seq 503 aa AA seqDB search
MNEQQYVMAIDEGTTSSRAIIFDHAGKEVAIAQKEFRQYFPQPGWVEHDAEEIWDSVQSV
ISEAVIKAQVKPYRIVAIGITNQRETTVIWDRKTGKPIARAIVWQSKQTAPIAERLIEEG
YTDQIHQKTGLVIDSYFSATKIKWLLDNVPGARERAKRGDLLFGTIDTWLLWNLTSGRVH
ATDVTNASRTMLFNIHTLDWDQDILDLLDIPREILPEVKPSSHVYGYTADYHFFGVQVPV
AGIAGDQQAALFGQGAFEKGSVKNTYGTGAFTVMNTGTTPMLSQNGLLTTVAYGIGNEVH
YALEGSIFVAGSAVQWLRDGLRLFKSAGESEQMAVDAQTTGGVYVVPSFTGLGAPYWDQE
VRGAMFGLTRGSSRENIVRATLEAIAYQTKDVVDTMVKDTNLPLTTLAVDGGASRNNFMM
QFQADLLQTPIVRAQIEETTALGAAFLAGLAVDFWEDQNELKQLAKSGDRFDPVMTKEEA
GRHYAGWQRAVDAVRYFSHGAEE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgagcaacaatatgtgatggccattgatgaggggacgacctcctcacgggcgatt
attttcgaccacgcgggtaaagaagtggcgattgcgcaaaaggaattccgtcagtacttc
ccccagcccggttgggtcgaacatgacgccgaagagatctgggatagcgttcaatcggtg
atttcagaggcggtcatcaaggcgcaagttaagccctaccggattgtggcgatcggaatt
actaaccagcgggaaaccacggtgatttgggaccggaagaccggtaaaccaatcgcccgg
gcgatagtgtggcaatcaaagcagaccgccccgattgctgaacgactaatcgaggagggc
tacacggaccagatccaccaaaagaccggcttagtcattgattcctacttctcggccacc
aagatcaagtggcttttggataacgtaccgggggcccgggagcgggctaaacgaggcgac
ctactctttggcaccatcgatacctggctcttgtggaatttaactagcgggcgggtgcac
gctacggacgttaccaacgccagccggacgatgctctttaacatccacacccttgactgg
gaccaagacattttagacctgctcgatattccccgggaaattttaccggaggtcaagccg
tcctcgcacgtctatggttacacggccgattaccacttcttcggggtccaagttccggtc
gccgggatcgccggggaccaacaggcggccctctttggccagggcgcctttgaaaagggg
agcgtcaagaatacgtacgggaccggggccttcacggtcatgaacaccgggacgacgcca
atgctttcgcaaaatggcctcctgacgacggtcgcctatgggattggcaacgaggtacat
tacgccctggaaggatcgattttcgtagcgggctcggcggttcagtggctccgcgatggg
ctacggctctttaagtcggccggggagtctgagcaaatggccgttgatgcccagaccacc
ggtggcgtgtatgtggtgccatcctttaccggtttgggggcgccctactgggatcaagag
gtccgcggggctatgtttggcctcacccgggggagtagccgggaaaatattgtccgggcc
accttggaggcaatcgcctaccagaccaaggacgttgtggacacgatggtcaaagacacc
aatttaccgttgaccaccctggcggtggatggcggggcgtcgcgcaataacttcatgatg
cagttccaagccgacctcttacaaacgccgattgtccgtgcccaaattgaagaaaccacg
gcgctaggggccgccttcttggctgggttggcggtggacttctgggaggatcaaaacgag
ctcaagcagttggctaagtcgggtgaccgttttgacccggttatgaccaaagaagaggct
gggcgtcactacgccggatggcaacgagccgtagatgccgttcgctactttagccacggt
gctgaggaatga

DBGET integrated database retrieval system