KEGG   Lactobacillus fermentum IFO 3956: LAF_1144Help
Entry
LAF_1144          CDS       T00699                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LAF_1144
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LAF_1144
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LAF_1144
Enzymes [BR:lfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LAF_1144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1318280..1319788)
Genome map
AA seq 502 aa AA seqDB search
MQYRSTRDQAAKQMTAPEAILQGLAPDGGLFVPQSFPQPDYDLGALVNAPYQEVATTIWG
WFFDDFSLASRQAIVRGAYGEQWDDSQIAPLSERVAGNYYLELFHGPTLAFKDVALQALP
RLMKEAVTVTGDDKQIIILTATSGDTGSAAMRGFSDVTGTQVVVFYPDGGVSPVQLRQML
AMKGDNLAAVAVAGNFDDAQTEVKKIFNDQEFAARLAQAGDRFSSANSMNIGRLIPQLTY
YFTAYGQLVKRGEVELGAPVNFAVPTGNFGDILAGYYAKKLGLPIKKLLCASNQNRVLTD
FFATGHYDRRRPFHLTTAPAMDILVSSNLERLLFDLYDQEAGAVASLMKELNQTGEYQVT
DEVLKRLHQDFVADWASEEEISEEIRRIYLAADYVIDPHTAVGSVVAHRYKERTGDNTPM
VVVATASPYKFAETVYPAVTGKETAARGLQAIQGLNEFLGEELSPGVKALFEGDQRSEQR
VEPSEMAQLIEKRLGLTSEQKE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcaataccgaagcacccgcgaccaagcggctaagcaaatgacggcgcccgaggcgatt
ttacaggggttagccccggacgggggcctctttgtgccccagtcgtttccccaaccagac
tacgacctgggggccctcgttaacgccccctatcaagaggtcgccaccaccatttggggc
tggttttttgacgacttttcgctggcgagccgtcaagcaattgtccggggggcctatggt
gagcagtgggatgattcccagattgcacccctaagcgagcgggtggcggggaattattac
ttagaactcttccacggcccaacgctggcttttaaggacgttgccttacaagcccttccc
cggttgatgaaggaggcggtcacggtgaccggtgatgataaacaaatcatcattttgacg
gccacttccggtgacactggctcggcggcgatgcggggctttagtgacgttaccgggacc
caagtagttgttttttacccggacggtggggtgagcccagtccaactgcgtcaaatgcta
gcgatgaagggggataacctggcggccgtagcggtggccggcaatttcgatgacgcccaa
accgaggttaaaaagatctttaacgaccaagaatttgccgctcggttagcccaggcgggc
gaccgcttttcgtcggcgaactcgatgaacattggccggctgattccccagcttacttat
tacttcaccgcttatggccagttggtcaagcgcggggaagttgaactcggcgccccggtt
aactttgccgtgccaaccgggaactttggggatatcctcgccggttactacgctaaaaaa
ttaggtctgccgatcaaaaagctcctgtgcgcctccaaccaaaaccgggtcctgaccgac
ttttttgcgaccggccactatgaccggcgccgccccttccacctcaccacggccccggca
atggacatcctagtttccagtaacttagagcgcctcttgtttgatctgtatgaccaagag
gcaggggcggtggcttccttaatgaaggaattgaaccaaacgggcgaatatcaagttacc
gacgaagttttaaagcgtctgcaccaagattttgtcgctgattgggccagtgaagaagaa
attagcgaagagattcgacggatctatttggcagctgactacgtcattgacccccacacg
gccgtgggttcggtggtggcgcaccgatataaagaacggacgggggataacaccccgatg
gtggtggtcgccaccgctagcccctacaagtttgccgaaacggtctacccggcggtaacg
ggaaaggaaacggcggcgcgcgggctgcaagcaattcaagggctcaacgaattcttaggt
gaggagttaagcccgggggtcaaggccctgtttgaaggggaccaacgctcagaacagcgg
gtggaaccaagtgagatggcccaactaattgaaaaacggctcggcttaacgagtgagcaa
aaggaataa

DBGET integrated database retrieval system