KEGG   Lactobacillus fermentum IFO 3956: LAF_1205Help
Entry
LAF_1205          CDS       T00699                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LAF_1205 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LAF_1205 (pyrB)
Enzymes [BR:lfe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LAF_1205 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1390618..1391583)
Genome map
AA seq 321 aa AA seqDB search
MTTQLVEQLVSLPHFVSVEDLTTDQVNALIARAEEFKNGAPAPELSQPVYVTNMFFENST
RTHTSFAMAEKKLGLTEIPFDASHSSIKKGETLYDTCLTLDALGVDLTVIRASENDYYLP
LINPGAGHYLGLGIVNGGDGSGQHPSQCMLDIMTIHEHFGHFKGLKVAIVGDITHSRVAR
SNMEILNKLGAEVYFSGPEYWYDHAFDKYGKFLPIDELVEEVDVMMLLRVQHERHAGDAH
EGDFSAADYHKQYGINEERYALLKPDTIIMHPGPINRGVELADSLVEAPKSAFVAQMGNG
VFMRMAMLEAVLRGRKLGGLE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccaactcgttgaacaactggtttctttaccacactttgtttccgttgaagat
ttaacgactgaccaagtcaacgccctgattgcccgggccgaagaattcaagaacggtgcg
ccggcaccggaactaagccagccggtttacgtgaccaacatgttctttgaaaactcgacg
cgcacccacacctcctttgcgatggccgaaaagaagctgggcttaaccgaaatccccttc
gacgcgtcccactcctcgattaaaaagggcgaaaccctttatgacacctgcttaaccctg
gatgccttaggcgttgacctaacggtgatccgggcgtccgaaaacgactactacctgcca
ctgatcaacccgggggcgggccactacctaggcctggggatcgtgaacggtggtgacggc
tccggtcaacacccatcccaatgcatgctagacatcatgaccatccacgaacactttggc
cactttaagggcctcaaggtggcgatcgttggcgacatcacccactcccgggtggcccgc
tccaacatggaaatcttaaacaagctcggcgccgaagtgtacttctccggcccggaatac
tggtacgaccacgcctttgacaagtacggcaagttcttaccgatcgacgaactggtcgaa
gaagtcgacgtcatgatgctcttacgggtccaacacgaacgccacgccggcgatgcccac
gaaggggacttctcggcggcagactaccacaagcaatacgggatcaacgaggaacgctac
gccctgctcaagccggacacgatcatcatgcacccgggcccgattaaccggggcgttgaa
ctagccgactccttagtcgaagccccaaagtcggccttcgtcgcccaaatgggaaacggg
gtcttcatgcggatggcgatgttagaagccgtactgcgcggtcgcaaactggggggcttg
gaataa

DBGET integrated database retrieval system