KEGG   Lactobacillus fermentum IFO 3956: LAF_1279Help
Entry
LAF_1279          CDS       T00699                                 

Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LAF_1279
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAF_1279
   00052 Galactose metabolism
    LAF_1279
   00500 Starch and sucrose metabolism
    LAF_1279
   00520 Amino sugar and nucleotide sugar metabolism
    LAF_1279
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LAF_1279
   00524 Butirosin and neomycin biosynthesis
    LAF_1279
Enzymes [BR:lfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LAF_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1462222..1463184)
Genome map
AA seq 320 aa AA seqDB search
MTNKKLIGVDLGGTTIKFAILTAEGEIQQKWSLRTNILDEGSHIVPDIIDSINHHIDLYK
MSKDQFIGIGMGTPGTIDLAKGTVKGAYNLNWKTTQNVKDQIEEGTGLKFALDNDANVAA
LGERWKGAGNDGDDVAFITLGTGVGGGLIANGELIHGLGAGGEVGHMIVQPNGYLCTCGN
HGCLEQYASATGVVHIAQDKAEEYEGNSRLKAMIDNGDEITSKIVFDLAKENDFLGNKVV
NQVAFYLGLACANLADALNPEFLVIGGGVSAAGDFLLKRVEKNFQEFAFPTVRTTTQLKL
AELGNDAGVIGAASLARRFA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacaagaagctgattggtgttgacttaggtgggacgacgattaagttcgctatc
ctgacggctgaaggggaaatccaacaaaagtggtcacttcggactaacattttggatgaa
ggttcccacattgtgccggacattattgactccatcaaccaccacatcgacctttacaag
atgagtaaggatcaattcatcgggatcgggatggggacgcccgggacgatcgacctggca
aaggggaccgttaagggtgcttacaacctgaactggaagacgacgcaaaacgtcaaggac
caaatcgaagaaggtaccggcctgaagtttgccctggacaacgacgccaacgtagcggcc
ctcggtgaacgctggaagggtgccggtaacgatggtgacgacgtggccttcatcaccctg
gggaccggggtcggtggtggcttgatcgccaatggtgaattgatccacgggctgggtgcc
ggtggtgaagttggccacatgatcgttcaaccgaacggttacctttgtacctgtgggaac
cacggttgcttagaacaatacgcttcggcaaccggggtggttcacattgcccaagacaag
gcggaagaatacgaaggtaattctcgcttgaaggcgatgatcgataacggggatgaaatt
acctctaagatcgtctttgacctggccaaggaaaacgacttcttaggtaacaaagttgtt
aaccaagtggccttctacctgggtctggcatgcgctaacttagccgacgccttgaaccca
gaattcctggtaatcggtggtggggtttccgctgccggtgacttcttgctcaagcgggtg
gaaaagaacttccaagaatttgccttcccaacagttcggacgacgacccaacttaagtta
gccgaattaggtaacgacgctggggtgatcggggcggcttccttggcacgccggtttgca
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system