KEGG   Lactobacillus fermentum IFO 3956: LAF_1336Help
Entry
LAF_1336          CDS       T00699                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LAF_1336
Enzymes [BR:lfe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     LAF_1336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1514882..1515964)
Genome map
AA seq 360 aa AA seqDB search
MLAQLATVEEQRFLFWQVDQAQQGAVIELIEHLDVPFASQADGIALMVKQAALPVLVKWA
KQAWPADDELQSSLEALTKETAILWRAGRFTFNVTAHPLVYGILNVTPDSFYDGGRYQAT
DDVKAHIDQMVKDGADIIEVGGQTTKPGGFVEVSPDEEIKRITPAIEYLKANYPAVAIAV
DTYKYPVMQAAVELGVDIINDVNAFLDDDQKLTLLKDSQVGLVTMHSSREHEYENLTVAM
KHFFEENLAMLEKAGIDRERVLLDQGIGYSKVADGEQDYAMMRNLDQFNYLKRPMIVAIS
RKGFGKQLFGLAKDDRLDVTLIAESYMYLHGGRVLRVHDVKETKQLVKTLDTITSGYWQL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgctagcgcaactggccacggtggaagaacagcgctttttgttttggcaagtcgaccaa
gcacagcagggcgccgttattgaattgatcgaacatttagacgtcccgtttgctagccaa
gcagacgggatcgccctaatggtcaagcaggccgccttaccagtgttggtcaagtgggct
aagcaagcctggccagccgatgacgaactccaaagctccttagaggcgctcactaaggaa
acggcgatcttatggcgggccggtcggttcacctttaacgtcaccgcccaccccttggtt
tacgggatcttaaacgtgacgccggactccttttatgacggcggacgctaccaagcaacc
gacgacgtcaaggcccacatcgatcagatggtcaaggatggcgccgacatcattgaggtt
ggtggccaaacgaccaagcccggtggctttgtggaagtaagtcccgacgaagaaatcaag
cggatcaccccggccatcgagtacttaaaggctaactacccggcggtggcaattgccgtg
gatacctacaagtacccggtcatgcaagcggccgtggaactaggggtggacatcattaac
gacgtcaacgcttttttggatgacgatcagaagttaaccctgctaaaagatagccaggtt
ggcctggtgacgatgcactcgagccgggaacacgaatacgaaaacctgacggtggcgatg
aagcacttcttcgaggagaacctggcgatgctagaaaaggccggtatcgaccgggagcgg
gttcttttggatcaggggattggctactccaaggttgccgacggggaacaagactacgcc
atgatgcgcaacctcgaccagttcaactatttgaagcggccgatgatcgtggcgatctcg
cgcaagggctttggtaagcaactctttggtctggccaaagacgatcgcctagacgtgacc
ctaattgccgaaagttacatgtacctgcacggcgggcgggtgctacgggtccacgacgtc
aaggagaccaagcagttagtaaagacgctcgacacgattaccagtggttactggcaactg
taa

DBGET integrated database retrieval system