KEGG   Lactobacillus fermentum IFO 3956: LAF_1340Help
Entry
LAF_1340          CDS       T00699                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
lfe00790  Folate biosynthesis
lfe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LAF_1340
Enzymes [BR:lfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     LAF_1340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: BAG27676
UniProt: B2GDE4
Position
complement(1518401..1518919)
Genome map
AA seq 172 aa AA seqDB search
MWTKAYLSIGTNMGDRLANLKQAVRLLERRPEIEVTSISSVYETAPVGGVVQANFLNIAV
GLSTNLSAWDLLAWLHVIEQSLHRRRLIHWGPRTIDLDIVLYGCTRLTSPTLKIPHLEMA
NRRFVLVPLQEIMPGKEQEYWHLAQLIRDTPDREWLTQRIKKEEVAEWIKKN
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtggactaaggcctacttgagcattggtactaacatgggggaccgcctggctaactta
aagcaagcggtgcggttgttagagcggcgcccggagatcgaggtaaccagcatttcgtcg
gtttacgagacggccccggtcggtggggtggtccaagcaaacttcctcaacattgccgtg
ggcctgtccactaacttaagcgcctgggacctgttagcctggctacacgtcattgaacaa
agccttcaccggcggcgtttaatccactggggcccgcggacgatcgacttagacatcgtt
ttgtatgggtgcacacggttaaccagccccaccctgaagattccccacctggaaatggcc
aaccggcgctttgtcctggtgcccctgcaagaaatcatgcctggcaaggaacaggaatat
tggcacctagcccaactaatcagggacaccccggaccgggagtggcttacccaacgaatt
aagaaagaggaagtagcagaatggatcaagaaaaattaa

DBGET integrated database retrieval system