KEGG   Lactobacillus fermentum IFO 3956: LAF_1662Help
Entry
LAF_1662          CDS       T00699                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
lfe00010  Glycolysis / Gluconeogenesis
lfe00052  Galactose metabolism
lfe01100  Metabolic pathways
lfe01110  Biosynthesis of secondary metabolites
lfe01120  Microbial metabolism in diverse environments
lfe01130  Biosynthesis of antibiotics
Module
lfe_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAF_1662
   00052 Galactose metabolism
    LAF_1662
Enzymes [BR:lfe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LAF_1662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: BAG27998
UniProt: B2GEB6
Position
1889304..1890347
Genome map
AA seq 347 aa AA seqDB search
MQITTSTFGTWQGQDVIKYTMENDNGVQVSVLNLAALLQAYAVPTKDGGHKNLVLSSDTV
AGFMDNGLCLNKSIGRVANRIGGGHFFIDGKEYQVEQNEGNNNIHGGSHGFKDQIWDAVT
DQVDDQLQVIFTKTFTEEMDTFPGTENARIVYTLHKDNSLTIDFFASSDQPTLFNPTNHT
YWNISDDDTIENIKLTLNSKHHLAVDEGKIPTGEKLVNEGTPYDFATATRMGDALAQMKA
QTAEGGFDDYFVVEPSNTLDHMPVAIMNDPATGREVKIYSDRNAMIMYTANGLDNDVKDL
DHPAQPWMAMALEGQTLPDAINNPAFGDTVLRPGKPQHYQLQYVVKY
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattacgacttcaacctttggtacttggcagggccaagacgtcattaagtacacg
atggaaaacgataacggcgttcaagttagcgtcttgaacctggccgctttgctgcaggcc
tacgccgttccaacgaaggacggcggccacaagaacctggtgctgtcctccgacacggtg
gccggcttcatggacaacggtctgtgcttaaacaagtcgattggccgggtggctaaccga
atcggcggcggccacttctttattgatggcaaagagtaccaagttgaacaaaatgagggg
aacaacaacatccacgggggttcccacgggtttaaggaccaaatttgggacgccgtgacc
gaccaagtcgacgaccaacttcaagtgatcttcaccaagaccttcaccgaggaaatggac
accttcccggggaccgaaaacgccaggatcgtctacaccctccacaaggacaacagtttg
acgatcgacttcttcgcttctagcgaccaaccaaccctgtttaacccgaccaaccacacc
tactggaacatcagcgacgacgacacgatcgaaaacatcaagctgaccttaaactccaag
caccacctggccgtggacgaaggtaagatcccgaccggcgaaaagctggttaacgagggc
accccgtacgacttcgccactgctacccggatgggcgacgccttggcccaaatgaaggcc
caaaccgctgagggcggctttgacgactacttcgtggtggaaccaagcaataccctggac
cacatgccggtcgccatcatgaacgacccggctaccgggcgtgaagttaagatctactcc
gaccgtaacgccatgatcatgtacacggccaacggcttggacaatgacgtcaaggacctc
gaccaccccgctcaaccgtggatggccatggccctggaaggtcaaaccctccccgacgcc
attaacaacccggcctttggtgacacggtcctgcgcccgggtaagcctcaacactaccaa
ctgcagtacgtggtgaagtactaa

DBGET integrated database retrieval system