KEGG   Lactobacillus fermentum IFO 3956: LAF_1666Help
Entry
LAF_1666          CDS       T00699                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lfe00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1892581..1893165)
Genome map
AA seq 194 aa AA seqDB search
MAGTTKPVFVITGAAGSGKTTVAKYLKDTYQMAKVITHTTRAPRPGEVDGVDYYFESPTS
IKDRHLLERVEYDGHLYGSSYEGLEAGWAKHPADVIVLDTAGALTYHQALGDQAVVIFLT
VSNPQTLAKRIKERGDQLDAVKSRLTSNEYRRDQSLPDYLKGIAHVIVNDDWAQTTQSLD
ALVAQVAPGVVQSS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaacaactaagcccgtctttgtgatcaccggggcggccgggagcggcaagaca
accgtggccaagtacctaaaggatacctaccaaatggctaaggtgatcacccacaccacc
cgtgccccgcggccgggtgaagttgatggagtcgattactactttgaaagccccacgtca
attaaggaccgccacttgctggaacgggtcgagtacgatggccacctctacggctcttct
tacgaggggctagaggccggctgggccaagcacccggccgacgtgatcgtcttggatacc
gccggcgctttgacctaccaccaggccctgggggaccaagcggtggtgatctttttgacc
gttagcaatccgcaaaccctagccaagcgaatcaaggagcggggcgaccagttggatgcc
gtgaagtcacgcctgacgtctaacgagtaccgccgcgatcaatcgctaccggactacttg
aaggggattgcccacgtgatcgtcaatgacgactgggcccagaccacgcaaagcctggac
gcattagtcgcccaggtcgcccccggggtggtacaatcaagctag

DBGET integrated database retrieval system