KEGG   Lactobacillus fermentum IFO 3956: LAF_1689Help
Entry
LAF_1689          CDS       T00699                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LAF_1689
Enzymes [BR:lfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LAF_1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1921733..1922653)
Genome map
AA seq 306 aa AA seqDB search
MTNRIAVLGSINVDTTYHVARFPEPGETLSATDKSSAPGGKGANQAVAAARSGAQTTFIG
MVGADNEGRFMREALQEDGVDTQFVGNDVRHGTGTALVTLDANGQNDIMVYGGANQAMTT
AVLDRTDDLWDQVDFLVSQFETPQEVTLAAFKLAKEHGVTTILNPAPAKEILPGLLAVTD
VIAPNETESALLTGIEINDEADLAKTADYFRGQGVATTLVTLGSRGAYFNHNGKSGIVPA
FKVKAVDTTAAGDTFIGGLVSQLTPSMENLADAITYAQRASSLTVQGMGAMPSIPTRAQV
EEALKN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgactaaccgcatcgccgttttagggagtattaacgtagacaccacctaccacgtcgct
cggttcccggaaccaggggagacgctgtcggctaccgacaagagctcggcaccggggggc
aagggggctaaccaagccgtggccgctgctcgttccggggcgcagacgaccttcatcggg
atggtgggcgccgataacgaagggcgtttcatgcgtgaagccctgcaagaagacggcgtt
gacacccagtttgttggcaatgacgttcgccacgggaccgggacggccctggtgacccta
gacgcaaacggccaaaacgacatcatggtttacgggggggccaaccaggcgatgaccacc
gccgtgttagaccggaccgacgacctgtgggaccaagtcgactttttggttagtcagttc
gaaactccgcaagaagtaaccctggcggcctttaagctggccaaggaacacggggtgacg
acaatcttaaacccggccccagccaaggaaattctaccgggcttgctggcggtgaccgac
gtgatcgcccctaacgaaaccgaaagcgccctgttaaccggaattgaaatcaacgatgag
gctgacctggccaagacggcggactacttccggggccaaggggtagctactaccttggta
accctgggtagccggggggcgtacttcaaccacaacggcaagagcgggattgtgccggcc
tttaaggttaaggcggtagatacgaccgcggccggcgacaccttcattggcggtctggtt
tcccaactgaccccgtcaatggaaaacctggcggacgccattacctacgctcaacgggcc
tccagcttgacggttcaagggatgggggcaatgccatcgatcccaacccgggcccaagta
gaagaagccttgaaaaactaa

DBGET integrated database retrieval system