KEGG   Lactobacillus fermentum IFO 3956: LAF_1747Help
Entry
LAF_1747          CDS       T00699                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LAF_1747
Enzymes [BR:lfe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     LAF_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1987128..1989527)
Genome map
AA seq 799 aa AA seqDB search
MAVDYNSKEYLETVDAYWRAANYLSVGTLFLMHNPLLRQELKASDVKPKPIGHWGTIVPQ
NFIYAHLNRVIKKYDLKMFYIEGSGHGGQVMVNNSYLDGSYTEIYPEITQDEAGMAKLFK
HFSFPGGTASHAAPETPGSLHEGGELGYSLSHGVGAILDNPDQIAAVEIGDGEAETGPLA
ASWFSDKFINPITDGAVLPILQINGFKISNPTILSRMSDEELTKYFEGMGWKPYFVSAYA
GGEFDGLKEHMEVHEEMAKVMDAAVEDILAIQKHARENNDDSMPQWPMIVFRVPKGWTGP
VKDLNGDPIENSFRAHQIPIPVTQDDMEHKDMLVDWMKSYKPEELFDENGAPVEKVVANT
PEGDRRMAVNPITNGGVNPKELVMPNYRDFAVDVKNHGTEMHQDMLEWGKYIAKMIELNP
TTFRGFGPDESKSNRLYAALDSGKRTWMEDIHEPNDEDLSHTGRIIDSQLSEHQAEGWLE
GYTLTGRHGFFATYESFGRVVDSMLTQHMKWLRKAKEQYWRHDYPALTFVDTSTVFQQDH
NGYTHQDPGLLTHLYEKERPDMIKEYLPADTNSLLAVSDVAFRDRECINVLVTSKHPRLQ
WFSIDEATELVANGLGYIDWASTDQGAEPDVVFASAGTEPTEEALAAIDLLHDNFPELKI
RYINVINIMKLMTIAKNPEGLSDEEFDRYFTADKPVIFAWHGFRDMIQSLFFPRHNRNLH
VHCYEENGDITTPFDMRVLNKLDRFHLAKDAILSVPGYEQKAVAFAQKMDDMVARHNHFI
RTEGKDLPEVEAWTWKGLK
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagattacaattccaaggaatacttggaaactgttgatgcttactggcgcgcc
gccaactaccttagtgttggtacgctgttcttgatgcacaacccactgttacgccaagaa
ctcaaggcttctgacgttaagccgaagccaattggtcactgggggacgattgttccgcaa
aacttcatttacgcccacttaaaccgggttatcaagaagtacgacctgaagatgttctac
atcgaaggttctggtcacggtggccaagtgatggttaacaactcttacttggacggttct
tacaccgaaatttacccggaaatcacccaagacgaagccgggatggctaagttgttcaag
cacttctccttcccaggtggaactgcttctcacgccgcaccggaaacaccaggttccctt
cacgaaggtggggaattaggttactccctttcccacggtgttggggcaatccttgacaac
ccagaccaaattgctgcggttgaaattggtgacggggaagccgaaactggcccattggct
gcttcatggttctctgacaagttcatcaacccaatcactgacggtgcggttctgccaatc
cttcaaatcaacgggttcaagatctctaacccaaccatcctttcccggatgtccgacgaa
gaactgactaagtacttcgaagggatgggctggaagccttactttgtatctgcatacgca
ggtggcgaatttgatggcctcaaggaacacatggaagttcacgaagaaatggctaaggtt
atggatgccgctgttgaagacatcctggctatccaaaagcacgctcgtgaaaacaatgac
gactccatgccacaatggccaatgatcgtcttccgtgtaccgaagggttggactggtccg
gttaaggacttgaacggcgacccgatcgaaaactccttccgtgcacaccaaattccgatt
ccggtgacccaagatgacatggaacacaaggacatgctcgttgactggatgaagtcttac
aagccagaagaactgttcgacgaaaacggtgctccggttgaaaaggttgttgctaacact
ccagaaggcgaccgccggatggctgttaacccgatcactaacggtggggttaacccgaag
gaactcgtgatgcctaactaccgtgacttcgccgttgacgtgaagaaccacggtactgaa
atgcaccaagacatgctcgaatggggtaagtacatcgctaagatgatcgaacttaaccca
actactttccgtggcttcgggccggacgaatctaagtctaaccgtctttacgctgccctt
gacagcgggaagcggacttggatggaagacatccacgaaccaaacgacgaagatctgagc
cacactggtcggatcatcgactcccaactttccgaacaccaagctgaaggttggctcgaa
ggttacaccctgactggtcgtcacgggttcttcgcaacttacgaatcatttggtcgtgtt
gttgactccatgctgactcaacacatgaagtggttacgtaaggccaaggaacaatactgg
cgtcacgactacccagcattgactttcgtggacacttccacggtcttccaacaagaccac
aacggttacactcaccaagatccaggtctgttgacgcacctttacgaaaaggaacgtcca
gacatgatcaaggaatacctgccagccgacacgaactccctgctcgctgtctctgacgtg
gctttccgtgaccgtgaatgcatcaacgtgctggttacttccaagcacccacgtctccaa
tggttctccatcgatgaagcaactgaactcgttgctaacggcctcggctacatcgactgg
gcatccactgaccaaggcgcagaaccagatgttgtctttgcttccgctggtactgaacca
actgaagaagctctggccgctatcgacctgcttcacgacaacttcccagaactgaagatc
cgttacatcaacgtgatcaacatcatgaagttgatgacgattgctaagaacccagaaggc
cttagcgacgaagaattcgaccgttacttcactgctgacaagccagtgatctttgcatgg
cacggcttccgtgacatgatccaaagtctcttcttcccacgtcacaaccgcaaccttcac
gtacactgctacgaagaaaatggtgacattaccactccattcgacatgcgtgtcctgaac
aaacttgaccggttccacttggccaaggacgctatcttgagcgtacctggttacgaacaa
aaggccgttgccttcgcacaaaagatggacgacatggttgctcgtcacaaccacttcatc
cggactgaaggtaaggacttaccagaagttgaagcttggacttggaagggcctcaagtaa

DBGET integrated database retrieval system