KEGG   Lactobacillus fermentum IFO 3956: LAF_1777Help
Entry
LAF_1777          CDS       T00699                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LAF_1777
  Lipid metabolism
   00561 Glycerolipid metabolism
    LAF_1777
   00600 Sphingolipid metabolism
    LAF_1777
Enzymes [BR:lfe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LAF_1777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2022493..2024715)
Genome map
AA seq 740 aa AA seqDB search
MPIKYHQKSREFHLYNNQISYIIKILRNDQLGQLFFGQRVPDRANHDYLVENTYRPVTLY
VDDNNYSFSLGNLKQEYPTYGTTDYRIPAFEVKQPNGSTITNFKYVSHKIFPGKPQLDNL
PATYTEDDSEATTLEILLHDSLINVDLVLRYTIFNNYNAIARSVKFINHSENSYQLTTAM
SLNLDLPDDNYDWLQFSGAWGRERQLKAAHLRPGIQAVDSTRGASSHMENPFIILKRPHT
DDFQGEAYGFSLIYSGNFLAQAEVDPYKVTRVQIGINPFHFSWKLNPQQSFQTPEAVMVY
THNGLNDLSQNFHRLYQQRLVRGYWRDRQRPILINNWEATYFDFTEEKLLALAKTAKNLG
IELFVLDDGWFGKRTTETAGLGDWWVNRDRLPDGISGLSAKIHDLGMMFGLWFEPEMTNK
DSDFYRQHPDYIIETPKRHASQGRKQYVLDFSRPEVVDYVYQLMAKVLREGKVDYVKWDM
NRNITECFSTAYPADQQGEIFHRYILGVYHLYDRLIHEFPKILFESCASGGGRFDAGMLY
YAPQAWTSDDSDAIERLKIQTGTSYCYPISSMGAHVSVSPNEQLQRQTPLKTRADVAYFG
AFGYELDLNTLSPEELAQVKRQIVFMKEHRQLFQFGTFYRLKTPFESNIVAWLVVSPDKK
HAIMGYFKILNDVNAEYRLQRIPGLDPLAEYHVKEEAGNIIGSFSGSELAKIGLVTTDAS
AGENKETTDFYSKLFTFDAQ
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgcctattaagtatcaccaaaagagtcgtgaatttcacctatacaataatcagataagt
tatattatcaagatccttcgtaacgaccagttagggcagcttttctttggtcaacgtgtt
cccgaccgtgctaatcatgattatttagttgaaaatacgtaccggccagttactttatac
gtggatgataacaattattctttttcattaggtaatttaaaacaagaatatcctacttat
gggacaactgactaccgtatacctgcctttgaagttaaacaaccaaatggcagcactatt
actaattttaaatatgtatcgcataaaattttccctggaaagccacaactcgacaactta
cccgctacctataccgaagatgacagtgaagcaaccactctcgaaatactccttcatgac
tcccttattaatgtcgacctcgtcctaagatatactatcttcaataattacaacgcgatt
gctcgtagtgttaaatttatcaatcatagtgaaaattcttatcaactaacaaccgccatg
agcttaaatcttgatttgccagatgacaattatgattggttacagttttctggagcatgg
ggacgtgaacgacaattaaaagctgcccaccttcgtccaggtattcaagcagttgacagt
accagaggcgcttctagtcacatggaaaatccatttattattttaaaaaggccccacact
gatgattttcagggtgaagcatatggcttttctttaatttatagtgggaattttcttgcc
caggctgaagttgatccttataaagttacgcgagttcagattggtatcaacccattccat
ttttcatggaaacttaatccgcaacaatctttccaaactccagaagccgtaatggtttat
acccataacgggcttaatgatctcagtcaaaacttccaccggctctatcaacaacgatta
gttcgcggatattggcgagaccggcaacgaccaatccttatcaataactgggaagcaacc
tactttgattttactgaggaaaaattgctagctctcgccaagaccgccaagaatttaggg
attgaacttttcgtccttgatgacggctggtttggtaaacgaacaactgaaacagccggt
ttaggtgactggtgggttaatcgagatcgtctcccagatggaattagtggcttatcagct
aagatccatgatttaggaatgatgtttggcctctggtttgaaccagaaatgaccaataaa
gatagtgacttttatcgtcagcatccagattatattattgagactcctaaacgacatgca
tcacaggggcgaaagcaatacgtccttgacttctcacgaccagaagtagtggattatgta
tatcaattaatggcaaaagttttacgtgaaggcaaggttgattacgtgaagtgggatatg
aatcgtaatattactgagtgcttttcaactgcataccctgctgatcaacaaggcgaaatt
ttccaccgttatattttaggcgtttaccatctttacgaccgcttaattcatgaattcccg
aaaattttatttgaatcttgtgctagtggcggtggtcgttttgacgccggaatgctttac
tacgctcctcaagcttggacaagcgatgattctgatgcgattgaacgtttaaaaattcaa
actggaacatcatattgttaccctatcagctcaatgggcgctcatgtctcggtctcacca
aatgaacaattacaacgacaaaccccgcttaaaacccgtgctgatgtcgcctactttggt
gcatttggttatgaattagacctaaatactttatcgccagaagaattagcccaagttaaa
cggcagattgtctttatgaaagagcatcgacaacttttccaatttgggactttctaccgt
ctaaaaacaccttttgaaagtaatattgtcgcctggctggttgtctctcccgataaaaag
catgcgattatgggatactttaagattcttaatgacgtcaatgcggaataccgcctacaa
cgcattcctggcctagatcctttagcagaataccatgttaaagaagaagctggtaatatc
attggctcctttagtggcagtgaacttgcaaagatcggtctcgttactactgacgcctca
gctggtgaaaataaggaaactactgatttttatagtaagttatttacctttgacgcgcaa
taa

DBGET integrated database retrieval system