KEGG   Lactobacillus fermentum IFO 3956: LAF_1820Help
Entry
LAF_1820          CDS       T00699                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
lfe  Lactobacillus fermentum IFO 3956
Brite
Enzymes [BR:lfe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     LAF_1820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2068975..2071098
Genome map
AA seq 707 aa AA seqDB search
MKYLSYSKKINLKEIRYMHKKQSNDQYLHYKMYKSGRKWVFAGVAALTLLTTTEVAHADT
TSSSAASTVSLNGSTVASEAAKATVTFISESTSATSSSSSTASSSSSSSSATSASSSSVA
TAATSVTSATSATSATSVSSTSADSSASAATSSDDASSSASAADANSGVSSASAATSATS
ASSTTVVRAVVAVATSASASSSSVDLSTLTFSNNASQQAFIESVAKGAIEGWNEYGVLPS
ITVAQAILESGWGSSTLSTQAHNLFGIKGSYNGNYVTMSTREVINGQSVYVNAAFRAYAN
NSESVEDHGNFLYSNSRYSNLLGDTSYTDVAQKLSQDGYATDPYYSSSLISLVKTYDLTQ
LDSIAIANTPVITNKSDYTQTNNGASTTATATYYTVQSGDTLSGIAVEYNTTTATLTSLN
NLSNPNLIYVGQRLLVKSASTAAASSATSTATSTASATSTSSTTSATTYTVKSGDTLSSI
ASSHNTTTAALTSLNSLANPNLIYVGQVLKLANTTTASTSSTSSAASTSSSAMTYTVKSG
DTLSSIASSYNTTTSTLTSLNNLSNPNLIYVGQVLKVAGSSTSVSTSTSSSSASQATTSG
TYTVKAGDTLSSIASSYNTTTAALASANSISNANLIYVGQVLKVTGTSSSTSTTTSSTSS
TSGSYTVKSGDSLSAIAAAHGLNWKTLAAKNNIASPYVIYVGQQLSL
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacttatcatactcaaagaagataaatctaaaggagatccggtatatgcacaaa
aagcaatcaaatgaccaatacctccactacaaaatgtacaaaagcggtcgcaagtgggtg
tttgctggggtcgcagctctgaccctgctaacaacgactgaagtggctcacgctgacacc
acgtcttcttcagctgcctccacggtcagcctcaacggttcaaccgttgccagtgaagcg
gctaaggccaccgttacctttatttcagaaagtaccagcgccactagttctagctcaagc
acggctagctcttctagctcttctagctctgctacctccgctagttctagttccgtggcc
acggcagctactagcgtaaccagtgccaccagcgctactagcgccacctcggtatcgtca
acgagcgctgacagctccgccagtgccgctacgtctagcgatgacgccagctcctcggcc
agcgcggcggatgccaacagcggcgtttcctccgctagtgccgccaccagtgctacgtca
gcaagctctaccactgtggtccgagcggtggttgccgtagccactagcgctagtgcaagt
tcttcgtccgttgacctgtcaacgttaaccttctccaacaacgcctcccaacaggccttc
atcgaaagcgtagctaaaggggcgatcgaaggttggaacgaatacggcgtcttgccgtcg
atcaccgttgcccaggccattctcgaatccggttggggttcatccaccctttccacgcaa
gcccataacctcttcgggattaaggggagctacaacggtaactacgtcacgatgagcacc
cgcgaagtgattaacgggcaaagcgtctacgttaacgccgccttccgggcttacgctaac
aactccgaatccgttgaagaccacgggaacttcctctactccaactcccgttacagcaac
ctcttaggtgacactagttacaccgacgtcgcccaaaagctttcccaagacggttacgct
accgacccttactactcttcctctttgatcagcttagttaagacctacgacctgacccaa
ttggacagcatcgccattgcgaacacgccggtgatcaccaacaagagcgattacacccaa
accaacaacggggcatccaccacggcgacggcaacttactacaccgtccaatccggcgac
accctgtccggaatcgccgttgaatacaacacgaccaccgcgacgttaacgagtttaaac
aacttatccaacccgaacttgatctacgttgggcaacggctcctggtcaagagcgcatca
actgcagcggcgtcatccgcaacttcaacggccaccagcaccgctagcgcaactagtacc
agctccaccactagtgccactacctacacggtcaagtctggtgacaccctcagctcgatt
gctagctcccacaacacgaccacggcggcgttgacgagcttaaacagcctggccaacccg
aacctgatttacgtgggccaagtccttaagttggctaacaccacgacggcaagcacgagt
tccaccagcagtgccgcttcaactagctcaagcgcaatgacttacacggttaagtccggt
gataccctgagttcgatcgccagttcctacaacacgaccacctcgacgttgacgagtttg
aacaacttatccaacccgaacttgatctacgtgggccaagtccttaaggtagccggctcc
tctaccagtgtttctaccagcactagttctagttcggctagccaagcaacgaccagtggt
acctacacggttaaagccggcgataccctcagttcgatcgctagctcctacaacacgact
acggcggcgttagctagtgccaacagcatttccaacgccaacttgatctacgtaggccaa
gtcctcaaggtcactggcacttcttcaagcaccagcaccaccactagttccacttcctca
accagtggttcttacaccgttaagtccggcgactcgctttccgccattgccgccgctcac
ggcttaaactggaagacgttagccgccaagaacaacatcgctagcccatacgtgatctac
gttggtcaacagttatcgctttaa

DBGET integrated database retrieval system