KEGG   Lactobacillus fermentum IFO 3956: LAF_1835Help
Entry
LAF_1835          CDS       T00699                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lfe00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lfe00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2086459..2087994)
Genome map
AA seq 511 aa AA seqDB search
MTMTLSGIITVLKDAGLFKELIVAGKWHDRAPEELANRTVLDLSYDSRTVKEGTLFFCKG
LKFDPKYLTMAANQGASVAMAPADYSAQLKTSEHPDLPQVIVTDIQKAMATVSRAFFGYP
DRNLTVIGYTGTKGKTTSVYFTRHVMAKALGKVVAQLSSIDECLDGETFIPAHLTTPESL
DLFRMMKEAVDNQMKYLVMEVSSQSYKKSRVFGLPLDIGVFLNISPDHISPVEHPSFEDY
LACKSEIIDNCRILVVNRECSQYDYLAEKAHDLGKQVISFGSDQSAADYQYRLGEHGYFT
VTTANPALPKLDGDFRVMMPGDFNVANALAALTVAAQVAPVSEDFRAGLAETTVPGRMEF
IKDKQGVVACVDYAHNYLSLTASFNFMKHEFKDGRLIVVIGAAGGKAESRRKDIGRALSQ
YADVAILTSEDNFFEDPHQIAADIKENIDNPDLEVIVNVDRKAAIEQAYAMAKPGDALFM
AAKGRETFMHEKGKDVPYQGDYQITKQLMEK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgacgctaagcggaattatcacggtcttaaaggatgcagggttgttcaaggaa
ttgattgtggccggcaagtggcacgaccgggcgccggaggagttggccaaccgcaccgta
ttagatctgtcttacgactcgcggacggtcaaagaggggaccctcttcttttgtaagggc
ctcaagtttgatcctaagtacctgacgatggccgctaaccagggggcgagcgtggcgatg
gccccggcggattactccgcccagttaaaaactagtgagcaccctgacttaccccaagtg
atcgttaccgatattcaaaaggcgatggcgaccgtgtcccgggccttctttggctacccg
gaccgcaacctgaccgtgattggctataccgggaccaaggggaagacgacctcggtttac
ttcacccgccacgtcatggccaaggccctggggaaagtggtcgcccagctttcctcgatt
gacgagtgtttggacggcgaaaccttcatcccggcccacttaacgacgccggagtcctta
gacctctttaggatgatgaaagaggccgtcgacaaccagatgaagtacttggtgatggag
gtttcttcccagtcctataagaagtcgcgggtctttggcctgccccttgatatcggcgtc
tttttaaacatctcgcccgaccatattagtccggtggaacacccgagctttgaagactac
ctggcctgcaagagtgaaatcatcgacaactgcaggatcctcgtcgttaaccgggagtgc
agtcagtacgattacctggccgaaaaggcacacgacctgggcaagcaggtaatttcattt
gggagcgatcaatcggcggccgattaccaataccgactgggtgaacacggttacttcacc
gttaccaccgctaacccggccctgcctaagcttgacggcgattttcgagttatgatgccg
ggggactttaacgtcgcaaacgccctggccgcattgaccgtggcggcccaagtggccccg
gtcagcgaggactttcgggcgggcctggccgaaacgaccgtgccaggacggatggaattt
atcaaggacaagcagggcgtggtggcctgcgtcgattacgcccacaactacttgagcctg
acggccagcttcaacttcatgaagcacgaatttaaagatggccgcttgatcgtggtgatc
ggggcggctgggggtaaggccgaatcccgccgtaaagacattgggcgcgccctgtcccag
tacgccgatgtggcgattttaacctctgaggataacttctttgaagaccctcaccagatc
gccgctgacattaaggaaaacattgataaccccgacctcgaggtcatcgtcaacgttgac
cgtaaggcggcaattgagcaggcctacgcaatggctaagcctggcgacgccctctttatg
gccgccaagggacgggaaacctttatgcacgaaaagggcaaggacgttccttaccaaggc
gactaccagattactaagcaattgatggagaaataa

DBGET integrated database retrieval system