KEGG   Lactobacillus fermentum F-6: LBFF_0466Help
Entry
LBFF_0466         CDS       T02669                                 

Definition
Thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lff  Lactobacillus fermentum F-6
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lff00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LBFF_0466
Enzymes [BR:lff01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LBFF_0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
519900..520481
Genome map
AA seq 193 aa AA seqDB search
MFFKYGAMNSGKSIDILKVAHNYEEQGKPVELLTSGIDDRAGTGVIASRIGLKRRVTPIM
EDTDVFELIKQIDHRIYCVLIDEAQFLSKAHVLQLCHVVDDLKIPVMAFGLKNDFKNELF
EGSEALLIYADKIEEMKTICWFCPRKATMNLRISDGHPVYQGAQVQIGGNESYYPVCREH
YFHPDLPSEQENE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttgttctttaagtacggcgcaatgaattctggtaagtcaattgacattctaaaggtggcc
cacaattatgaggagcagggcaagccggttgaattgttgacgagcggaattgatgaccgg
gccggcaccggggtgatcgccagccggattggtttgaaacggcgggtcacgccgatcatg
gaggacaccgacgtttttgaactgatcaaacaaatcgatcaccggatttactgtgttttg
attgacgaggcccagttcttgagtaaggcccacgtactgcaactatgccacgtggttgac
gacctcaagatcccggtgatggcctttgggctcaaaaacgactttaaaaacgagttgttt
gagggatccgaggccctgttgatctacgccgataagattgaagagatgaagacgatctgc
tggttttgcccccgcaaggcaaccatgaacctgcggattagcgatgggcacccggtttac
caaggcgcccaggttcaaatcggcggcaacgagtcctactacccggtttgccgggaacac
tattttcacccagatttgccaagtgaacaggagaatgagtaa

DBGET integrated database retrieval system