KEGG   Lactobacillus fermentum F-6: LBFF_0466Help
Entry
LBFF_0466         CDS       T02669                                 

Definition
Thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lff  Lactobacillus fermentum F-6
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lff00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
519900..520481
Genome map
AA seq 193 aa AA seqDB search
MFFKYGAMNSGKSIDILKVAHNYEEQGKPVELLTSGIDDRAGTGVIASRIGLKRRVTPIM
EDTDVFELIKQIDHRIYCVLIDEAQFLSKAHVLQLCHVVDDLKIPVMAFGLKNDFKNELF
EGSEALLIYADKIEEMKTICWFCPRKATMNLRISDGHPVYQGAQVQIGGNESYYPVCREH
YFHPDLPSEQENE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttgttctttaagtacggcgcaatgaattctggtaagtcaattgacattctaaaggtggcc
cacaattatgaggagcagggcaagccggttgaattgttgacgagcggaattgatgaccgg
gccggcaccggggtgatcgccagccggattggtttgaaacggcgggtcacgccgatcatg
gaggacaccgacgtttttgaactgatcaaacaaatcgatcaccggatttactgtgttttg
attgacgaggcccagttcttgagtaaggcccacgtactgcaactatgccacgtggttgac
gacctcaagatcccggtgatggcctttgggctcaaaaacgactttaaaaacgagttgttt
gagggatccgaggccctgttgatctacgccgataagattgaagagatgaagacgatctgc
tggttttgcccccgcaaggcaaccatgaacctgcggattagcgatgggcacccggtttac
caaggcgcccaggttcaaatcggcggcaacgagtcctactacccggtttgccgggaacac
tattttcacccagatttgccaagtgaacaggagaatgagtaa

DBGET integrated database retrieval system