KEGG   Lactobacillus fermentum F-6: LBFF_1472Help
Entry
LBFF_1472         CDS       T02669                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lff  Lactobacillus fermentum F-6
Pathway
lff00330  Arginine and proline metabolism
lff00332  Carbapenem biosynthesis
lff01100  Metabolic pathways
lff01130  Biosynthesis of antibiotics
lff01230  Biosynthesis of amino acids
Module
lff_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lff00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LBFF_1472
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LBFF_1472
Enzymes [BR:lff01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LBFF_1472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase Inj_translocase
Motif
Other DBs
NCBI-ProteinID: AGL89365
UniProt: R4RJ51
Position
complement(1492179..1492970)
Genome map
AA seq 263 aa AA seqDB search
MADKERIVVKIGTSSLIQENGRVNLASIDRLAFTLACVNNQGYQPILVSSGAIGVGLASL
GLTKRPAEIARQQALASIGQTELMRIYSQRFLDYQTKVGQILITRDVLTFPVSLQHVIDT
FEVLLADKVIPIVNENDPVAVDELDHHTMFSDNDELSAQVAVKVGASKLIVLSDIDAFYD
ADPHQDPDAKVIRHVEQLTPEMEAAAGGSGSGLGTGGMVTKLRAAKTMLAAGKQMILCNG
KDPAIIKDVLAGKEIGTRFGKGN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcagataaagaacgaattgtggttaagattgggacctccagcctaatccaagaaaac
ggccgggtcaacctagcctccatcgaccggttagcctttaccctagcttgcgttaacaac
cagggataccaaccgatcctggtttcttccggggccatcggggtggggttagccagtttg
ggcttgaccaagcggccggcggaaatcgcccgccagcaggccttagcctcgattgggcaa
accgagttgatgcggatctactcccaacgcttcttggattaccaaactaaggtcggccag
atcctgattacccgggacgtgttgaccttcccggttagcttgcaacacgtaatcgacacc
ttcgaggtcctcttggccgataaggtaatcccgatcgtcaacgaaaacgacccggtcgcc
gttgacgaactcgatcaccacaccatgttttcggacaacgacgagttatcggctcaggtg
gccgtcaaggttggcgcaagcaagctgattgtcttgtctgacatcgacgccttttacgac
gccgatccccaccaagaccccgacgccaaggtgattcgccacgttgaacagctgacgccg
gaaatggaggcggccgccgggggcagtggcagcggcctgggaaccggggggatggtgacc
aagttgcgggcggctaagacgatgttggctgcgggcaagcagatgattttatgtaacggt
aaggacccggcgatcattaaggacgtacttgccggtaaggaaattggaactcgctttgga
aaggggaattaa

DBGET integrated database retrieval system