KEGG   Leptospirillum ferriphilum: LFML04_0043Help
Entry
LFML04_0043       CDS       T02319                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
lfi  Leptospirillum ferriphilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(46156..47262)
Genome map
AA seq 368 aa AA seqDB search
MDSESSTETKNAGEIARRTLQDLAREKKAPTPFHYARFYARHAGLHSDGLLEKMLDLVGI
FSYLDEDDWTGKQVEELRSFLPRTIFLSETGVDIEMDRILDETIARNRVLSQEVRHRKQE
INQTVNQLNEIITQAHLLINQTSVRLEKSLERFNTVKSLEEAKPIFLDIVQQSKTLLDRF
RTIGEEFQEAHKLLMSSSIEASLDPLTGTLNRRGFQKRIGSSVGMDIVLLIFDLDHFKQL
NDRQGHHQGDLVLKRIAGLVNGLLDGSNAVFSRWGGDEFLVMFPRKNLEEIVAIAEEIRT
RIEKEVLGTSSETEPSGQGMTISVGLSAGRLDSEEQFDRFYNLADQALYLAKKEGRNRTR
AIHLEDAR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtggattcggaatcctcgaccgaaacgaaaaacgccggagagatcgctcgtcggacgctc
caggatctcgctcgggaaaaaaaggcaccgaccccttttcattacgcgcggttctatgcc
cgccacgcgggtctgcactccgacggtctgctggaaaaaatgctcgatctcgtcgggatt
ttttcctacctcgacgaagacgactggaccggaaaacaggtcgaggaactccggagcttt
ctcccccggacgatctttctgtccgagaccggcgtcgacatcgagatggaccggatcctc
gatgagacgatcgcccggaacagggttctttcgcaggaagtccgccaccggaaacaggaa
atcaaccaaaccgtcaaccagctgaacgagatcatcacccaggcgcatctgttgatcaac
cagacgtccgttcgcctggaaaaaagtctcgaacgttttaacaccgtcaaaagcctcgaa
gaagcgaaaccgatttttctggatatcgtccagcagtcgaaaacacttcttgaccggttc
aggaccatcggggaagagtttcaggaagcccacaagctcctgatgagttccagcatcgag
gcaagtctcgacccgctcaccggaaccctcaaccggagagggttccagaaacggatcggc
tcttcggtcggcatggacatcgtccttctgatcttcgatctggatcatttcaagcaattg
aacgatcgtcaggggcaccaccagggagatctggtcctcaaacggatcgccggcctcgtg
aacggccttctcgacgggtcgaacgccgtcttttcccgatggggcggggacgaatttctg
gtgatgtttccccggaaaaatctggaagaaatcgttgccattgcggaggagatccggacc
cggatcgaaaaagaagtcctgggtacctcttccgagaccgaaccgtccggtcaggggatg
accatcagcgtcggcctttccgccggacgcctggactccgaagagcagttcgaccggttt
tacaacctggccgaccaggccctctatctggccaaaaaagaagggcggaacagaacccgg
gcgatccacctggaggatgcgcggtaa

DBGET integrated database retrieval system