KEGG   Leptospirillum ferriphilum ML-04: LFML04_0125Help
Entry
LFML04_0125       CDS       T02319                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lfi  Leptospirillum ferriphilum ML-04
Pathway
lfi00330  Arginine and proline metabolism
lfi00332  Carbapenem biosynthesis
lfi01100  Metabolic pathways
lfi01130  Biosynthesis of antibiotics
lfi01230  Biosynthesis of amino acids
Module
lfi_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lfi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LFML04_0125
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LFML04_0125
Enzymes [BR:lfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LFML04_0125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA DUF4224
Motif
Other DBs
NCBI-ProteinID: AFS52377
UniProt: J9Z9M4
Position
121422..122564
Genome map
AA seq 380 aa AA seqDB search
MKSEEMKSRSEILSSTRTLVLKVGSTVLASPQAGVNMRVLGVIARQVAWLRARGIRVVIV
SSGAIAAGRMKLDFGKKPLTLAMKQAAASVGQSRLMWGYERAFSPHRLMVSQVLLTPRDV
VRRSRFTNLERTLETLLALGVVPVVNENDSVATEEIRFGDNDRLSALVSGTVKADFLLIL
SDVDGLYTSDPSRNPNAIPIPYVEKVTSDIESLAGISRSGLGTGGMASKVLTARWANRWG
LPVGIVNGRKGAPVERFFEGGGTLFFARKKLWAAKKVWIGFFSEPSGTLVLDEGAMKAIS
HGKSSLLAGGITRHEGVFESGEVVRLLSATGHEIGRGVCRMPSSEVALWTRRKSSGERSA
DSWPLAVHRNTMVLWEREEE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcggaggaaatgaagtcccggtcagaaatcctctcttccacccggacgctggtt
ctgaaagttggcagcacggttctcgcttcaccgcaagcgggtgtcaatatgcgggtatta
ggggtcattgcccgtcaggtggcatggttacgggcaagagggatacgtgttgtcatcgtt
tccagtggtgcgatcgcggccggccggatgaagcttgatttcggtaaaaagccattgacc
ctggccatgaagcaggcggcagcctctgttggacaaagccggcttatgtgggggtacgaa
agagcgttttctccccatcgtctgatggtgtcccaggttctcctgaccccccgtgacgtt
gttcgaagaagtcgtttcaccaatctggaaagaaccctcgaaaccctcctcgcactgggt
gtcgttccggttgtgaacgaaaatgattccgttgccaccgaggagatccggttcggggat
aacgatcgcctttccgcactggtatccgggaccgtcaaggcggattttcttctcatcctt
tcggatgtcgatggcctgtatacgtccgatccctcccgaaatccgaatgcgataccgatt
ccgtatgtggaaaaggtgacatccgacatcgaaagccttgccggaatctcccggtcgggg
cttggaacaggggggatggcttccaaagtcctgaccgcccgttgggcgaaccggtggggc
cttccggtcgggatcgtgaatggacgcaagggagccccggttgagcgtttttttgagggc
gggggcacacttttctttgccagaaaaaaactctgggcggccaaaaaagtatggattgga
tttttttccgaaccatccggcactcttgtcctggatgaaggggcaatgaaagccatttct
catgggaaatccagccttctggccggtggaattacccgtcatgaaggagtttttgagtcc
ggggaggtcgttcgcctgttgtctgcgaccggtcacgagatcgggcgaggggtctgccgg
atgccttcttccgaagtcgctctctggacgcgccggaagtcgtcaggagaaagatctgcg
gactcctggccgttggctgttcacaggaacacgatggtcctttgggaaagggaagaggag
taa

DBGET integrated database retrieval system