KEGG   Leptospirillum ferriphilum: LFML04_0125Help
Entry
LFML04_0125       CDS       T02319                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lfi  Leptospirillum ferriphilum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lfi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LFML04_0125
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LFML04_0125
Enzymes [BR:lfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LFML04_0125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
121422..122564
Genome map
AA seq 380 aa AA seqDB search
MKSEEMKSRSEILSSTRTLVLKVGSTVLASPQAGVNMRVLGVIARQVAWLRARGIRVVIV
SSGAIAAGRMKLDFGKKPLTLAMKQAAASVGQSRLMWGYERAFSPHRLMVSQVLLTPRDV
VRRSRFTNLERTLETLLALGVVPVVNENDSVATEEIRFGDNDRLSALVSGTVKADFLLIL
SDVDGLYTSDPSRNPNAIPIPYVEKVTSDIESLAGISRSGLGTGGMASKVLTARWANRWG
LPVGIVNGRKGAPVERFFEGGGTLFFARKKLWAAKKVWIGFFSEPSGTLVLDEGAMKAIS
HGKSSLLAGGITRHEGVFESGEVVRLLSATGHEIGRGVCRMPSSEVALWTRRKSSGERSA
DSWPLAVHRNTMVLWEREEE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcggaggaaatgaagtcccggtcagaaatcctctcttccacccggacgctggtt
ctgaaagttggcagcacggttctcgcttcaccgcaagcgggtgtcaatatgcgggtatta
ggggtcattgcccgtcaggtggcatggttacgggcaagagggatacgtgttgtcatcgtt
tccagtggtgcgatcgcggccggccggatgaagcttgatttcggtaaaaagccattgacc
ctggccatgaagcaggcggcagcctctgttggacaaagccggcttatgtgggggtacgaa
agagcgttttctccccatcgtctgatggtgtcccaggttctcctgaccccccgtgacgtt
gttcgaagaagtcgtttcaccaatctggaaagaaccctcgaaaccctcctcgcactgggt
gtcgttccggttgtgaacgaaaatgattccgttgccaccgaggagatccggttcggggat
aacgatcgcctttccgcactggtatccgggaccgtcaaggcggattttcttctcatcctt
tcggatgtcgatggcctgtatacgtccgatccctcccgaaatccgaatgcgataccgatt
ccgtatgtggaaaaggtgacatccgacatcgaaagccttgccggaatctcccggtcgggg
cttggaacaggggggatggcttccaaagtcctgaccgcccgttgggcgaaccggtggggc
cttccggtcgggatcgtgaatggacgcaagggagccccggttgagcgtttttttgagggc
gggggcacacttttctttgccagaaaaaaactctgggcggccaaaaaagtatggattgga
tttttttccgaaccatccggcactcttgtcctggatgaaggggcaatgaaagccatttct
catgggaaatccagccttctggccggtggaattacccgtcatgaaggagtttttgagtcc
ggggaggtcgttcgcctgttgtctgcgaccggtcacgagatcgggcgaggggtctgccgg
atgccttcttccgaagtcgctctctggacgcgccggaagtcgtcaggagaaagatctgcg
gactcctggccgttggctgttcacaggaacacgatggtcctttgggaaagggaagaggag
taa

DBGET integrated database retrieval system