KEGG   Leptospirillum ferriphilum: LFML04_0178Help
Entry
LFML04_0178       CDS       T02319                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lfi  Leptospirillum ferriphilum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lfi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(170818..171462)
Genome map
AA seq 214 aa AA seqDB search
MGSHASRDFSNKSPYPLPFHHLIESLRTLPGIGIKTATRLAFHLLKAPEAEALQLSREIS
GLREALVLCPQCQNIMDRDSRLSCCTICSDPARDPGTVMVVEDIQTLYSIERTGEFRGRY
HVLLGRLSPLEGIGPEALRVRELLDRTGTGEIHEMILATSPTVEGESTALYLARLFKPLG
VKVSRIAFGIPVGLELEFVDDITLIRSVEARRPM
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgggatcgcatgcaagcagggacttttcaaacaaatctccctacccgcttccttttcat
cacctgatcgaatctctcaggacgctgccgggcatcggaatcaagacagccacccggctc
gcctttcatcttctcaaggcaccggaggcggaggcgttgcagctttcccgggaaatctcc
ggacttcgtgaagcgctggttctctgcccccaatgccagaacatcatggaccgcgattcc
cggctctcgtgttgtacaatatgttcggatcccgcgcgcgacccgggaacggttatggtt
gttgaagatatccagaccctttactccattgagcggaccggagaattccgggggcgttat
catgttcttcttggccggctctctcctcttgaggggatcggaccggaagcgctcagggtc
cgggaacttctggaccggactggaaccggagaaattcatgaaatgattctcgcaacatcc
ccgaccgtggaaggagaatcgacagccctctacctggctcgcctcttcaagcctctcggc
gtgaaagtgagccggatcgcttttggcatcccggttggtctcgaactggagtttgtcgac
gatatcaccctgatacggtctgtcgaagcaagacgcccgatgtga

DBGET integrated database retrieval system