KEGG   Leptospirillum ferriphilum ML-04: LFML04_0384Help
Entry
LFML04_0384       CDS       T02319                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lfi  Leptospirillum ferriphilum ML-04
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lfi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LFML04_0384
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LFML04_0384
  Lipid metabolism
   00071 Fatty acid degradation
    LFML04_0384
  Amino acid metabolism
   00350 Tyrosine metabolism
    LFML04_0384
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LFML04_0384
   00626 Naphthalene degradation
    LFML04_0384
Enzymes [BR:lfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LFML04_0384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
354279..355283
Genome map
AA seq 334 aa AA seqDB search
MKKMVVARVGPLGFDSLSVENTPEPVPGSGEVLVRVEACGVCRTDLHVIEGDLPESAPGI
VPGHEVVGRVAKTGPGVSDLSPGQRVGVAWLYRSCGECRYCRKGAENLCVSPLFTGYHRP
GGYAEALVANAAFVYPLPENMPAEQLAPLLCAGIIGYRALSRLGLSRGSHLGLYGFGASA
HLVLQMARDQGMRVSVGSRGDRHQAFARSMGADWVGGPAETPEEPLDGAILFAPAGPLVL
PILRRLDRGGRLLIAGIHLSDIPAIEYEPFLFYEKSLGSVTANTRDDGRKLLEWASKGTI
VPRTTVYPLEEAVRALRDLKEDRIEGAAVLKVGG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatggtcgtggccagagtcggtcccctcggattcgactcgttaagcgtggaa
aacactcccgaacctgttccgggctccggagaggttctcgtgcgtgtggaggcctgcgga
gtttgccggaccgatcttcatgtcattgagggggatttgccggaaagcgcgccaggcatt
gttcccggccatgaggttgtcgggcgcgtcgcaaagacaggtcccggggtgtcggacctg
tcccccggacagagagtcggggtggcctggctgtaccgttcctgcggggaatgccggtat
tgtcggaaaggggccgaaaatctgtgcgtctctcccctttttacgggctatcaccggccg
ggtgggtatgccgaagccctggtggccaatgccgcctttgtctatccgctgccggagaac
atgccggccgaacagctggcccctcttttgtgcgccgggatcatcggttaccgggctctt
tcccggcttggactttcccggggatcccatctcggcctctacggcttcggtgcgtcggcg
catcttgttcttcagatggctcgggatcaggggatgcgtgtctctgtcggaagccgcggc
gaccgccatcaggcgtttgcccgatccatgggagccgattgggtcggagggccggccgaa
accccggaagaaccactggacggcgccattctcttcgccccggccggccctctcgtgctg
ccgatcttgcgacgtctcgacagaggcggacgccttctcatcgcgggaatccatctgtcg
gacattccggcaatcgaatacgaaccttttctgttttatgaaaagtctctggggtcggtc
accgcgaacacccgggacgacgggcgaaagcttctggagtgggcatcgaaggggaccatc
gttccccggacgaccgtctatccgctggaagaggccgtgcgcgctcttcgggatctgaag
gaggaccgtattgaaggagccgcggtcctgaaggtgggcggataa

DBGET integrated database retrieval system