KEGG   Leptospirillum ferriphilum: LFML04_0726Help
Entry
LFML04_0726       CDS       T02319                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase(rfbC)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lfi  Leptospirillum ferriphilum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:lfi00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:lfi00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
646149..646700
Genome map
AA seq 183 aa AA seqDB search
MKVIETPIRGLLRIRPDVHGDERGFFLESFHAKKFAALGIPHLFVQDNHSRSARGVLRGL
HFQKRHPQGKLVRVLSGSLFDVAVDLRHGSPTFGHWFGLTLSAGDPEFLYLPEGMAHGFL
ALEDRTELFYKCTDFYDPADEGGLRWNDPAIGIAWPETPAVLSPKDAAFPVLAKILPEDL
PRV
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtgatcgaaacgccgatccggggactgctccgcatccgtccggatgtgcacggg
gacgaaaggggatttttcctggagagctttcacgcaaaaaaatttgcggctctgggaatc
ccgcatctgttcgtccaggacaatcattcccgttcggcccggggtgttctccggggactg
cactttcaaaagcgtcaccctcagggaaagctggtccgggtcctgtccgggtcgctattc
gacgtggccgtggaccttcgacacggctccccgactttcgggcactggttcggtctgaca
ctttccgcaggggaccccgagttcctgtatcttccggagggcatggcgcacggatttctc
gctctggaagaccggacggaactgttttacaagtgcaccgatttctatgatccggcggac
gaaggcggtctccgctggaacgaccccgccattggaatcgcctggccggagacccctgcc
gttctctccccgaaggacgcggcgtttccggtcctggcaaagattttgccggaggatctg
ccgcgtgtgtga

DBGET integrated database retrieval system