KEGG   Leptospirillum ferriphilum ML-04: LFML04_0744Help
Entry
LFML04_0744       CDS       T02319                                 

Definition
hypothetical protein
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
lfi  Leptospirillum ferriphilum ML-04
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LFML04_0744
Enzymes [BR:lfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     LFML04_0744
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     LFML04_0744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
670819..672396
Genome map
AA seq 525 aa AA seqDB search
MTGRGERLPLLDTPHSWEDFLSWGPSSALPAILREYLPRCRWFGDKSRQIDEVRIESVLP
LDVGNNSPVFLCILSVTFLEGVARRYFLPLGLGAEAQSGPAGPVARIPSVDQAVVVDALF
LPETGNGLLDLFFSGDDRPSEIRPVSTPLLPGLLASRPLEGSPRAFGGEQSNTSLLFGRS
LILKCYRNLETGTNPDLEIGAFLAEAKTPAPIPPTGGALVSFTPEGRSLTIALLQGFVEN
RGDGWSFLLGGLQEIRLRGVPEEEEKDPGGVRIGRWIETLGERTADLHQGLGRDPDHPDF
APVPFTEDDIDELVFGIETRHERVMRMLAKTRPALPPGLQERIDRFSGMAGFLGRTLVSC
RRAGRGGWKIRCHGDLHLGQVLVTAGDDAVFLDFEGEPALPIDERRKKSSPLNDVAGMLR
SFHYLVASSRPEESDGRWERWLSAWLSAQSRRFWEAWRRRMDSGAVRLLGEEEPTHALLT
LFLIRKCLYEIEYEINNRPAWIGIPLEGLQALLEGKGPGGGAGVS
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgggaggggggagcgactccctcttctggacaccccgcactcctgggaggatttt
ctctcctgggggccgtcttccgctttgccggcgattcttcgggagtatcttccccgttgc
cggtggttcggggacaagtcccgacagatcgacgaggtccggatcgaatctgttcttccc
ctggacgttggcaacaacagtcctgttttcctgtgtattctctccgtgacattcctggaa
ggggtcgcccggcgctatttccttccgttggggctgggtgccgaagcccaatccggaccc
gccggtcccgtggcccgaattccgtccgttgaccaggcggtcgttgtggatgccctgttt
ctccccgaaacggggaacggtcttctggacctgtttttttccggagacgaccgtccgtca
gaaatccggccggtgtcgacgccgctcttgcccggtctcctggcctcccgtcctctggag
ggctctccccgcgctttcgggggagagcagagcaacacgtcccttcttttcggtcgatcc
ctgatcctgaaatgctaccggaacctcgaaacgggaacgaatccggacctggagatcgga
gcctttctggcggaggcgaaaactccggctcccattcctccgaccggcggagcgctcgtg
tcgttcaccccggaggggcgctccctgacaatcgcgcttctccaggggttcgtcgagaac
cggggggacgggtggagcttcctgctgggtgggctgcaggagatccgattgcggggagtg
ccggaggaagaggaaaaagatcccgggggggtccggattggccgttggatcgagacgctg
ggggaaaggacggccgacctgcatcagggtctgggacgagacccggaccatccggatttc
gccccggttccattcaccgaggacgacatcgatgaactggtgtttggaatcgaaacccgg
cacgagagggtgatgcggatgctggcgaaaacccgtccggctcttccccccgggctccag
gagaggatcgaccgcttctccggaatggcgggatttctcggccggacactggtgtcctgt
cgacgggcggggagaggaggctggaagatccgctgtcacggagacctccatctcggtcag
gtcctggtgacggccggtgacgatgccgtcttcctcgatttcgagggagagccggctctt
ccgattgacgaacggcggaaaaagtcctctcccctgaatgatgtggctgggatgctccgc
tcttttcactacctggtcgcctcgtcgcgtccggaggaatccgatggacgatgggagcga
tggctttccgcatggctttcggcccagtcccgccgcttctgggaggcctggcgacgcaga
atggacagcggtgccgtccgtctcctgggcgaggaggagccgacccacgccctcttgact
ctctttctgatccggaaatgcctgtatgaaatcgaatacgagatcaataaccgtcccgcc
tggatcggaattcccctggaagggctccaggctcttctggagggcaaagggccgggcggg
ggagcgggtgtatcttga

DBGET integrated database retrieval system