KEGG   Leptospirillum ferriphilum ML-04: LFML04_0776Help
Entry
LFML04_0776       CDS       T02319                                 

Gene name
galU2
Definition
UTP-glucose-1-phosphate uridylyltransferase(galU)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lfi  Leptospirillum ferriphilum ML-04
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lfi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LFML04_0776 (galU2)
   00052 Galactose metabolism
    LFML04_0776 (galU2)
   00500 Starch and sucrose metabolism
    LFML04_0776 (galU2)
   00520 Amino sugar and nucleotide sugar metabolism
    LFML04_0776 (galU2)
Enzymes [BR:lfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LFML04_0776 (galU2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(707434..708357)
Genome map
AA seq 307 aa AA seqDB search
MQKVRKAVFPLAGHGTRFLPMTKSSPKEMLPIIDKPVVQYVVEEAVESGIRQIVMVTGRG
KRAIEDHFDISYELEDVLRKKNKLDILAELQRIASLSEITYIRQKEALGLGHAVLCSEMV
VGNEPFAVALGDEILYGPKSGLAQLLEVYEELQAPVIGLQRVPRSEVSHYGIVDGTPVRD
GLFRVDRLVEKPKTQDAPSDYAIIGRYILTPDVYGILGTQKPGVGGEIQLTDALNTLARQ
RPVYAMEIQGDRFDTGDKMGFLKATVHFALKRGDLSEEFRLFLEGVLTQGQLNPEPETPG
ETVYANR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaggttcggaaagccgtttttcccctcgccggtcacggcacccgttttctgccc
atgaccaaatcctcccccaaggaaatgcttccgatcatcgacaaaccggtcgtccagtat
gtcgtggaagaggcggttgaatcgggaatccggcagatcgtcatggtgacgggaagggga
aaaagggcgatcgaagaccacttcgacatctcctacgagctggaagacgttctccgcaaa
aaaaacaaactcgacattcttgccgaactccagagaattgcgtctctgtcggaaatcact
tatatccggcaaaaggaagccctcgggctcggacacgctgtcctctgctcggagatggtg
gtcgggaacgagcccttcgccgtcgccctgggggacgagatcctctacggacccaagtcg
gggctcgcccagcttctggaagtctacgaggaactccaggccccggtcataggccttcag
cgggtgccgcgttccgaagtcagccactacggcatcgtggacggcactcccgtccgggac
ggactctttcgcgtagaccggctcgtcgaaaagccgaaaacccaggacgcgccttccgat
tatgccatcatcggccggtatatcctgacgccggatgtctatggcattctcgggacccaa
aaaccgggggtcggcggcgagatccagctgacggatgccctgaacactctggcccgccag
cgtcctgtctatgccatggaaatccagggagaccgcttcgacaccggggacaagatgggc
tttctgaaagccacggtgcattttgccctcaaaagaggggacctttcggaagagtttcgg
cttttcctggaaggagtcctgacccagggacaactgaatccggagccggaaactcccgga
gaaacggtgtatgcgaaccgatag

DBGET integrated database retrieval system