KEGG   Leptospirillum ferriphilum: LFML04_0776Help
Entry
LFML04_0776       CDS       T02319                                 

Gene name
galU2
Definition
UTP-glucose-1-phosphate uridylyltransferase(galU)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lfi  Leptospirillum ferriphilum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lfi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LFML04_0776 (galU2)
   00052 Galactose metabolism
    LFML04_0776 (galU2)
   00500 Starch and sucrose metabolism
    LFML04_0776 (galU2)
   00520 Amino sugar and nucleotide sugar metabolism
    LFML04_0776 (galU2)
Enzymes [BR:lfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LFML04_0776 (galU2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(707434..708357)
Genome map
AA seq 307 aa AA seqDB search
MQKVRKAVFPLAGHGTRFLPMTKSSPKEMLPIIDKPVVQYVVEEAVESGIRQIVMVTGRG
KRAIEDHFDISYELEDVLRKKNKLDILAELQRIASLSEITYIRQKEALGLGHAVLCSEMV
VGNEPFAVALGDEILYGPKSGLAQLLEVYEELQAPVIGLQRVPRSEVSHYGIVDGTPVRD
GLFRVDRLVEKPKTQDAPSDYAIIGRYILTPDVYGILGTQKPGVGGEIQLTDALNTLARQ
RPVYAMEIQGDRFDTGDKMGFLKATVHFALKRGDLSEEFRLFLEGVLTQGQLNPEPETPG
ETVYANR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaggttcggaaagccgtttttcccctcgccggtcacggcacccgttttctgccc
atgaccaaatcctcccccaaggaaatgcttccgatcatcgacaaaccggtcgtccagtat
gtcgtggaagaggcggttgaatcgggaatccggcagatcgtcatggtgacgggaagggga
aaaagggcgatcgaagaccacttcgacatctcctacgagctggaagacgttctccgcaaa
aaaaacaaactcgacattcttgccgaactccagagaattgcgtctctgtcggaaatcact
tatatccggcaaaaggaagccctcgggctcggacacgctgtcctctgctcggagatggtg
gtcgggaacgagcccttcgccgtcgccctgggggacgagatcctctacggacccaagtcg
gggctcgcccagcttctggaagtctacgaggaactccaggccccggtcataggccttcag
cgggtgccgcgttccgaagtcagccactacggcatcgtggacggcactcccgtccgggac
ggactctttcgcgtagaccggctcgtcgaaaagccgaaaacccaggacgcgccttccgat
tatgccatcatcggccggtatatcctgacgccggatgtctatggcattctcgggacccaa
aaaccgggggtcggcggcgagatccagctgacggatgccctgaacactctggcccgccag
cgtcctgtctatgccatggaaatccagggagaccgcttcgacaccggggacaagatgggc
tttctgaaagccacggtgcattttgccctcaaaagaggggacctttcggaagagtttcgg
cttttcctggaaggagtcctgacccagggacaactgaatccggagccggaaactcccgga
gaaacggtgtatgcgaaccgatag

DBGET integrated database retrieval system