KEGG   Leptospirillum ferriphilum ML-04: LFML04_0889Help
Entry
LFML04_0889       CDS       T02319                                 

Gene name
thrC_1
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lfi  Leptospirillum ferriphilum ML-04
Pathway
lfi00260  Glycine, serine and threonine metabolism
lfi00750  Vitamin B6 metabolism
lfi01100  Metabolic pathways
lfi01110  Biosynthesis of secondary metabolites
lfi01120  Microbial metabolism in diverse environments
lfi01230  Biosynthesis of amino acids
Module
lfi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lfi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LFML04_0889 (thrC_1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LFML04_0889 (thrC_1)
Enzymes [BR:lfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LFML04_0889 (thrC_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NinF ADK_lid
Motif
Other DBs
NCBI-ProteinID: AFS53121
UniProt: J9ZAD8
Position
824689..825969
Genome map
AA seq 426 aa AA seqDB search
MSNPSVSPQPSPKGQKPSRMKGLKCRECGRIYDLAPVHVCDFCFGPLEVDYDYEAIRTLM
SRDSIARGPNSLWRYKHLLPVADEPTIGLHAGMTPLVRAERLGKALGLKNLYIKNDTVNH
PTLSFKDRVVAVAINRAKELGFRTVACASTGNLANSVSAHAASAGMECFVFIPHDLEAGK
ILGNLIYRPTVVAVRGNYDDVNRLCSEIGGEYPWAFVNINIRPYYAEGSKTMAFETAEQL
GWRIPDQVVVPIASGSLLTKIWKGFQEMSRLELVPSHPGLRVNGAQAQGCSPVYQAFMAG
RTQFVPVKPKTIAKSLAIGNPADGYYALDVIGKSRGQVEAASDPEIVEGMVLLAETEGIF
AETAGGVTVACLKKLAEKGAIRPDELTVAYITGNGLKTMEALNGFLPEPVSIDPTLASFQ
KIVNPS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacccgtctgtatcaccccagccctcccctaaagggcaaaagccttcccggatg
aagggtcttaaatgccgcgaatgtggacggatctatgatcttgcgcccgttcacgtctgc
gatttctgttttggtccgctggaagtggactacgattacgaggctatccggaccctcatg
agccgggactcgattgccagaggtcccaattctctctggaggtacaagcatcttctgccg
gttgccgatgagccaacgatcggacttcacgcaggaatgacacccctggtccgggcagag
cgtctgggaaaagctctcggtctgaaaaatctttatattaaaaacgacacggtcaatcat
ccgactctgtcgttcaaggaccgggttgttgcggttgcgatcaatcgcgcgaaggaactc
ggttttcgcactgttgcctgcgcgtcgaccggaaatctggccaactcggtgtctgctcat
gcggcgagtgccggaatggaatgctttgtcttcattccccacgacctggaggcgggcaag
atcctgggtaatcttatttaccgtccgaccgtggttgccgtccggggaaactacgacgac
gtgaaccggctctgcagtgaaattggaggagagtatccctgggcgtttgtcaacatcaat
attcgcccgtactatgcggaaggttcaaagacgatggcttttgaaacagccgagcaactt
ggctggaggatccccgaccaggtggtggttcccatcgcttccggatcgctgttgacgaaa
atctggaaaggatttcaggagatgtcccgtctggaactcgtgccttctcatccgggtctt
cgggtcaacggcgcccaggcacagggatgttctcccgtctatcaggcgtttatggcaggt
cgaacacaatttgttcccgtcaagcccaagacaattgcaaaatcccttgcgatcggcaat
ccggcggacggatattacgccctcgacgtgattggaaaatcacgggggcaggtggaagcg
gcttcggatcccgaaatcgtggaaggaatggtgcttcttgccgagacggaggggattttt
gcagagacggctggaggggtgacagtggcctgcctcaagaaactggcggaaaaaggggct
attcgaccggatgaactgacggtggcctacatcacaggaaacggtctcaagaccatggag
gctcttaacggattccttcccgaacccgtttccatcgaccccacgctggcctcgttccag
aaaattgtcaatccgtcctga

DBGET integrated database retrieval system