KEGG   Leptospirillum ferriphilum ML-04: LFML04_1021Help
Entry
LFML04_1021       CDS       T02319                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
lfi  Leptospirillum ferriphilum ML-04
Pathway
lfi00010  Glycolysis / Gluconeogenesis
lfi00030  Pentose phosphate pathway
lfi00051  Fructose and mannose metabolism
lfi00052  Galactose metabolism
lfi00230  Purine metabolism
lfi00500  Starch and sucrose metabolism
lfi00520  Amino sugar and nucleotide sugar metabolism
lfi00521  Streptomycin biosynthesis
lfi01100  Metabolic pathways
lfi01110  Biosynthesis of secondary metabolites
lfi01120  Microbial metabolism in diverse environments
lfi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LFML04_1021
   00030 Pentose phosphate pathway
    LFML04_1021
   00051 Fructose and mannose metabolism
    LFML04_1021
   00052 Galactose metabolism
    LFML04_1021
   00500 Starch and sucrose metabolism
    LFML04_1021
   00520 Amino sugar and nucleotide sugar metabolism
    LFML04_1021
  Nucleotide metabolism
   00230 Purine metabolism
    LFML04_1021
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LFML04_1021
Enzymes [BR:lfi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     LFML04_1021
    5.4.2.8  phosphomannomutase
     LFML04_1021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFS53252
UniProt: J9ZC21
Position
complement(960396..961799)
Genome map
AA seq 467 aa AA seqDB search
MIHPDPKIFREYDIRGNADRDLSDATVYAIGKAYASLLKESGGKRVALGQDVRLSSPRIA
RSMEDALLASGVDVLDVGKVPTPLLYFSLFKLPVDGGIMITGSHNPAADNGIKMAIGKET
IFGSAIQEIRKRTSFAPSTNGHPSRKGVRTNSPIRETYLSEMAANFGKLPLFHNRPLRVV
LDCGNGTAGLVAQDLFSPLGIELHCLYQDPDGHFPHHHPDPTVPENLSDLIAHVKKNQAD
LGIAFDGDSDRIGVVTESGHILFGDQLLLLFAQQVLESRPGSVILSEVKASRILYDEVAR
MGGKPLMWKAGHSLIKAKMKETKAPLAGEMSGHIFFADRYYGYDDALYAGIRLLELLTLR
QKTLSELLAPFPKAVSTPEIRRDSTDDRKFLVVSRLREILLQKNYTFSDIDGVRIDFSDG
WGLVRASNTQPVLVLRFEGPTPQRRDAIQQEIEALLSEAEKTLPQTS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgattcatcctgatccaaagatttttcgtgaatacgatatccggggaaatgcagaccgc
gacctttcggatgcgactgtttacgcgatcggaaaggcctatgcctctcttctgaaagaa
tccggcggaaaacgggtggctcttggacaggacgtccggctgtcttcaccaagaattgcc
agatccatggaagatgcccttctggcgtcgggagtcgacgttctcgacgtcggcaaggtt
ccgacgccccttctctatttttctcttttcaagcttccggtggacggtggcatcatgatc
accggcagtcataaccccgctgccgacaatggaatcaagatggccatcgggaaggagacc
attttcggcagcgccattcaggaaatccgaaaacggacctcttttgccccctccaccaac
ggtcacccctccagaaaaggggttcggacaaactctcccatccgggaaacctatctttcg
gaaatggccgccaactttggaaagctgcccctttttcacaatcgtcccctgcgcgttgtc
ctcgattgcgggaacggaacagccggtctcgtcgcacaggatcttttctcccccctggga
atcgaactgcactgcctataccaggatccggacggacatttccctcaccatcacccagac
ccgactgtcccggaaaatctctccgacctgatcgcgcacgtcaaaaaaaaccaggcggac
cttggaatagcctttgacggagactccgaccggatcggtgtcgtgacagaatcgggacat
atactgtttggggatcagcttcttcttcttttcgcacagcaggtcctggaatcccgtccg
ggctctgtgatcctctcggaagtcaaggcatcccggattctttatgatgaagttgcccga
atgggcgggaaaccgctcatgtggaaggccggtcattccctgatcaaagcgaagatgaaa
gaaacaaaagcccctcttgctggagaaatgagcggacacatcttctttgcggatcgctat
tatgggtacgacgatgccctctatgccggcattcgtcttcttgaacttctgacccttcgg
caaaaaaccttgtccgaattgcttgctccttttccaaaagcggtttcgacaccggaaatc
agaagagactccaccgatgatcgcaaatttctggtggtgtcccgtcttcgtgagatcctc
ctgcaaaagaactacacgttttccgacattgatggggtccggatcgatttttcggacggc
tggggacttgtgcgcgcctccaacacccaacccgttctggttttaagatttgaaggtccc
actccgcaaagaagagacgcgattcagcaagaaatcgaagcccttctgtccgaagccgaa
aaaactctccctcaaacctcctga

DBGET integrated database retrieval system