KEGG   Leptospirillum ferriphilum ML-04: LFML04_1021Help
Entry
LFML04_1021       CDS       T02319                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
lfi  Leptospirillum ferriphilum ML-04
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LFML04_1021
   00030 Pentose phosphate pathway
    LFML04_1021
   00051 Fructose and mannose metabolism
    LFML04_1021
   00052 Galactose metabolism
    LFML04_1021
   00500 Starch and sucrose metabolism
    LFML04_1021
   00520 Amino sugar and nucleotide sugar metabolism
    LFML04_1021
  Nucleotide metabolism
   00230 Purine metabolism
    LFML04_1021
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LFML04_1021
Enzymes [BR:lfi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     LFML04_1021
    5.4.2.8  phosphomannomutase
     LFML04_1021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(960396..961799)
Genome map
AA seq 467 aa AA seqDB search
MIHPDPKIFREYDIRGNADRDLSDATVYAIGKAYASLLKESGGKRVALGQDVRLSSPRIA
RSMEDALLASGVDVLDVGKVPTPLLYFSLFKLPVDGGIMITGSHNPAADNGIKMAIGKET
IFGSAIQEIRKRTSFAPSTNGHPSRKGVRTNSPIRETYLSEMAANFGKLPLFHNRPLRVV
LDCGNGTAGLVAQDLFSPLGIELHCLYQDPDGHFPHHHPDPTVPENLSDLIAHVKKNQAD
LGIAFDGDSDRIGVVTESGHILFGDQLLLLFAQQVLESRPGSVILSEVKASRILYDEVAR
MGGKPLMWKAGHSLIKAKMKETKAPLAGEMSGHIFFADRYYGYDDALYAGIRLLELLTLR
QKTLSELLAPFPKAVSTPEIRRDSTDDRKFLVVSRLREILLQKNYTFSDIDGVRIDFSDG
WGLVRASNTQPVLVLRFEGPTPQRRDAIQQEIEALLSEAEKTLPQTS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgattcatcctgatccaaagatttttcgtgaatacgatatccggggaaatgcagaccgc
gacctttcggatgcgactgtttacgcgatcggaaaggcctatgcctctcttctgaaagaa
tccggcggaaaacgggtggctcttggacaggacgtccggctgtcttcaccaagaattgcc
agatccatggaagatgcccttctggcgtcgggagtcgacgttctcgacgtcggcaaggtt
ccgacgccccttctctatttttctcttttcaagcttccggtggacggtggcatcatgatc
accggcagtcataaccccgctgccgacaatggaatcaagatggccatcgggaaggagacc
attttcggcagcgccattcaggaaatccgaaaacggacctcttttgccccctccaccaac
ggtcacccctccagaaaaggggttcggacaaactctcccatccgggaaacctatctttcg
gaaatggccgccaactttggaaagctgcccctttttcacaatcgtcccctgcgcgttgtc
ctcgattgcgggaacggaacagccggtctcgtcgcacaggatcttttctcccccctggga
atcgaactgcactgcctataccaggatccggacggacatttccctcaccatcacccagac
ccgactgtcccggaaaatctctccgacctgatcgcgcacgtcaaaaaaaaccaggcggac
cttggaatagcctttgacggagactccgaccggatcggtgtcgtgacagaatcgggacat
atactgtttggggatcagcttcttcttcttttcgcacagcaggtcctggaatcccgtccg
ggctctgtgatcctctcggaagtcaaggcatcccggattctttatgatgaagttgcccga
atgggcgggaaaccgctcatgtggaaggccggtcattccctgatcaaagcgaagatgaaa
gaaacaaaagcccctcttgctggagaaatgagcggacacatcttctttgcggatcgctat
tatgggtacgacgatgccctctatgccggcattcgtcttcttgaacttctgacccttcgg
caaaaaaccttgtccgaattgcttgctccttttccaaaagcggtttcgacaccggaaatc
agaagagactccaccgatgatcgcaaatttctggtggtgtcccgtcttcgtgagatcctc
ctgcaaaagaactacacgttttccgacattgatggggtccggatcgatttttcggacggc
tggggacttgtgcgcgcctccaacacccaacccgttctggttttaagatttgaaggtccc
actccgcaaagaagagacgcgattcagcaagaaatcgaagcccttctgtccgaagccgaa
aaaactctccctcaaacctcctga

DBGET integrated database retrieval system